KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_1930Help
Entry
SDSE_1930         CDS       T02333                                 

Definition
(GenBank) K10907 aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00220  Arginine biosynthesis
sdc00250  Alanine, aspartate and glutamate metabolism
sdc00290  Valine, leucine and isoleucine biosynthesis
sdc01100  Metabolic pathways
sdc01110  Biosynthesis of secondary metabolites
sdc01130  Biosynthesis of antibiotics
sdc01210  2-Oxocarboxylic acid metabolism
sdc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SDSE_1930
   00290 Valine, leucine and isoleucine biosynthesis
    SDSE_1930
   00220 Arginine biosynthesis
    SDSE_1930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdc01007]
    SDSE_1930
Enzymes [BR:sdc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SDSE_1930
    2.6.1.66  valine---pyruvate transaminase
     SDSE_1930
Amino acid related enzymes [BR:sdc01007]
 Aminotransferase (transaminase)
  Class I
   SDSE_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCI63411
UniProt: K4QBA4
LinkDB All DBs
Position
complement(1831901..1833115)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPEVDIEDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEADWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEVLEDIVALAREHQLIIFADEIYDRLVMDGEEHVAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIHEAINAIPGLSAVKPKAGLYLFPKIDRNMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPTVEELEDVQEKITRVLHQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgtcgcctacgacattcgaggtcct
gttttagacgaggccaaccgtatgattgctaacggtgaaaaaatccttcgattaaacacc
ggtaacccagcggcttttgggtttgaggctcctgatgaggtcatccgtgatttgattgtc
aatgcgaggcttagtgaagggtattcagatagcaagggtatcttttctgcccgcaaagcc
attatgcaatattgtcagctgaaaggtttcccggaggtagatattgaggatatttatttg
ggaaatggggtgtcagaattaatttccatgtcattacaagccctgcttgatgatggggat
gaggtgttggttcctatgccagattaccctctatggacagcctgtgtcagtctgggtggt
ggcaaagctgtgcattacttgtgtgatgaagaagcggattggtatcctgacattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaaccctaacaatccc
actggtgccctttaccctaaagaagtcctagaagatattgttgcccttgcaagagagcac
cagctgattatttttgccgatgaaatctatgaccgattggttatggacggagaggagcat
gttgccattgctagtttagcgccagatgtattttgtgtatccatgaatggcttatcaaaa
tcccatcgtattgctggtttccgagtaggttggatggtcttatctgggccaaaagatcac
gtgaaaggctatatcgaaggattgaatatgctagcgaatatgcgcctctgctccaatgtg
ttggcccaacaggtagtgcaaacatctctaggcggtcgtcagtctgttgatgagctcttg
ttgccaggtggacgtatttttgagcaacgtaattttatccatgaagccatcaatgcgatt
ccaggcttatctgcagttaaacccaaagcaggtctttacctttttcctaagattgatcgt
aatatgtatcgtatcgatgatgatgaagaatttgtgctccaattattaaaacaagaaaag
gtgatgttggttcatggccgaggcttcaactggaaggacccagaccacttccgaattgtg
tacttaccaaccgtggaagaattagaagatgttcaggaaaaaatcacccgcgtcttacat
cagtacaaacgctaa

DBGET integrated database retrieval system