KEGG   Saccharophagus degradans: Sde_0825Help
Entry
Sde_0825          CDS       T00335                                 

Definition
(GenBank) putative bifunctional family GT51 b-glycosyltransferase/PBP transpeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
sde  Saccharophagus degradans
Pathway
sde00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sde_0825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sde01003]
    Sde_0825
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sde01011]
    Sde_0825
Enzymes [BR:sde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Sde_0825
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sde_0825
Glycosyltransferases [BR:sde01003]
 Polysaccharide
  Bacterial polysaccharide
   Sde_0825
Peptidoglycan biosynthesis and degradation proteins [BR:sde01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Sde_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter DUF3385
Motif
Other DBs
NCBI-ProteinID: ABD80087
UniProt: Q21MJ2
LinkDB All DBs
Position
1075024..1077357
Genome map
AA seq 777 aa AA seqDB search
MPRKTSPRKAQPRKTHRRPLWRRLLRIVFLLGVGFSIPFSIYLVYLDRIVVQQFEGKRFA
LPAKVYARPLELYVGQKINADVLQAELKELGYKPVENVVLAGQFSRTRDQFDIYIRPFTF
WDGEQQASHIQLTLNNGQVRSLKNKSELAPLNLVRLDPITIGGIYPNHGEDRELVRLHQV
PQVLIDALIAVEDRRYYQHHGVDPKAILRAATTLITSERVQGGSTITQQLIKNFFLTRER
TIERKVKEMLMAILLELHFSKDDILETYLNEVYFGQDRNRAIHGFGLASQFYFSRPIEHL
EPHQAALLVGMLKGPAYYNPRQHPKRATERRNLVLNALADQNYISDSTYRQQVLQPLVIS
ELPGLGQSRHPAFMQLVVRQLKRDYRETDLQSEGLRIFTTLDPYEQKVAEQQLTKNLQQL
EKARSLPHSHLQGAVIIANVHDGEVKAVVGGRDSHYQGFNRALDASRQIGSLIKPAIYLT
ALADIEHYNLATPLDDSPFEWSEPGIEPWRPQNYDHEFHGTVPLWLALAKSYNVSAARLG
TQIGVDNVMRTVANLGVEKSLPTYASSLLGTVHLTPYEITQMYHTIASGGFKTPFRAIRE
VTTVNGAPLNRYNLSVEQVVTPTANHLIVAGLQQVVARGTGTGVLNYIADDIHAAGKTGT
TDDLRDSWFAGFTGNRVAVVWVGNDKNEPIKLTGASGALRIWGDIMKNLSLEPLNAAAPE
NVDYVPISHRDGFVARDNCNNTFTLPFHTKSLPDADYCGAKTGRKVKSWFNKLFGKD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
ttgccccgtaaaacctcgccccgtaaggcccaacctcgtaaaacccaccgccgtccgctt
tggcgtcgcttattgcgcattgtctttttgcttggtgtgggtttctctataccttttagt
atttacttggtttatctcgatcgcattgtggtgcaacaatttgagggcaagcgctttgct
ttgcctgccaaggtgtatgctcggccgttagagttgtatgtggggcaaaaaataaatgcc
gatgtgctgcaggcagaattaaaagagttaggctacaaaccggtagaaaatgtagtttta
gcggggcagtttagccgcacgcgcgatcagtttgatatatacatacgcccttttaccttt
tgggatggcgagcagcaagcaagtcatatacagctcacccttaataatgggcaagtgcgc
agtttaaaaaataaaagcgagctagcaccgcttaaccttgtgcgtttagacccaataacc
atcggcggtatttaccccaatcacggtgaagatagagaacttgtacgcctgcaccaagtg
ccacaagtgcttattgatgcgctaatagccgtggaagacagacgctattatcagcatcac
ggggtggaccccaaagccatattgcgcgctgcaaccacgttaattaccagtgagcgcgtg
cagggcggcagcaccattacccagcagctaatcaaaaactttttcttaacacgcgagcgc
accatagagcgcaaagtaaaagaaatgcttatggcaatcttgctagagctgcattttagt
aaagacgatattttagaaacctatctcaacgaagtgtactttgggcaagatcgcaaccgc
gctattcacggctttggtttggcgagccagttttatttctcgcgccctattgaacattta
gaacctcatcaagcagcgctgttggtgggaatgctaaaagggccagcctattacaacccg
cgccagcaccctaagcgcgcaactgagcgccgcaacttggtgttaaatgcgctggccgat
caaaattacattagcgatagcacctacaggcaacaagttttgcagcccttagtcataagt
gaattgccgggcttggggcaatcgcgtcaccccgcatttatgcaattggtggtgcgtcag
ttaaaacgcgattaccgcgaaaccgatttgcaatctgaaggcttgcgcattttcactacg
ctcgacccttacgagcaaaaagtcgccgagcaacaattaacgaagaatttgcagcagcta
gaaaaagcgcgcagcttgccgcatagccatttgcagggcgcggtgataatagccaacgtg
cacgacggcgaagtaaaagccgttgtgggcggtcgcgatagtcattaccaaggttttaat
cgcgcgttagatgcgtcccgtcaaattggctcgcttataaagcccgccatttatttaacc
gcactggcagatattgaacactacaacttggcaacgccattagatgacagccccttcgag
tggagtgagccgggcatagaaccttggcgcccgcaaaactacgatcacgagtttcacggt
acggtgccgctctggttggcactggctaaatcgtacaatgtgtcggcggcgcgtttgggt
acgcaaataggtgtagataacgttatgcgcaccgtggccaaccttggggtagaaaagtca
ctgcctacctatgcttctagtttgctgggtaccgtgcaccttacgccttacgaaataaca
cagatgtaccacaccatagcgagtgggggctttaaaactccgtttcgcgcaattcgcgag
gtaaccacagtaaatggtgcgccgcttaatcgttacaaccttagcgtagagcaagtggta
acccccaccgccaaccacttaattgtggcaggtttacagcaggtggttgcgcgcggtacc
ggcaccggcgtgctgaattatattgctgatgatatacacgcagccggcaaaaccggtaca
acggatgacttgcgcgatagttggtttgcgggttttaccggtaatcgcgtagcggtggtg
tgggttggtaacgataaaaacgagccgataaaacttaccggtgccagcggcgcactaaga
atttggggcgacattatgaaaaatttgtcgctcgaaccccttaacgctgcggcaccagaa
aatgtagactacgtgcccatcagtcatcgcgacgggtttgttgcgcgcgataactgcaat
aatacttttactttgccttttcacactaaatcgctgcccgatgccgactactgcggtgct
aaaactgggcgcaaggtaaagtcttggtttaacaaattatttggaaaagattaa

DBGET integrated database retrieval system