KEGG   Saccharophagus degradans: Sde_1659Help
Entry
Sde_1659          CDS       T00335                                 

Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sde  Saccharophagus degradans
Pathway
sde00020  Citrate cycle (TCA cycle)
sde00270  Cysteine and methionine metabolism
sde00620  Pyruvate metabolism
sde00630  Glyoxylate and dicarboxylate metabolism
sde00680  Methane metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Module
sde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sde_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sde_1659
   00620 Pyruvate metabolism
    Sde_1659
   00630 Glyoxylate and dicarboxylate metabolism
    Sde_1659
  09102 Energy metabolism
   00680 Methane metabolism
    Sde_1659
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sde_1659
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Sde_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ABD80919
UniProt: Q21K60
LinkDB All DBs
Position
2127173..2128156
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQISYSLLFRIAAGEMLGKDQPVILQMLEITPALEALKGVAMELDDC
AFPLLAGMVCSDDPNVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSVQGKAINDHA
SRDIKVLVVGNPANTNALIAQRNAPDINPRQFTAMMRLDHNRGLSQLAAKLDVTLEDITK
MTIWGNHSATQYPDLFHTLVKGDVAVEQVEKDWYENDFIPTVQQRGAAIIKARGASSAAS
AANAAIFHMRDWALGTPENDWVSMGVYSDGSYGIEEGLIYSFPCVCKNGDWEIVQGLTID
EFSRAKMTATENELKEERDAVKSLLPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacccgttcgtgttgccgttaccggcgccgctggtcaaatcagctactctttg
ttgttccgcatcgccgctggcgaaatgttgggcaaagatcaacccgtaattctacaaatg
ttagaaattaccccagctttagaagcgcttaaaggcgtagcgatggagttggatgactgt
gctttcccgcttttggctggaatggtatgttcggacgacccaaatgttgcttttaaagat
gccgattacgcattgcttgttggtgcgcgtcctcgtggaccaggcatggagcgtaaagac
cttctagaagctaacgctgctattttctctgtgcaaggtaaagcgattaacgatcacgct
tcacgcgacattaaagtattggttgtaggtaaccctgcaaacaccaacgctttgattgct
cagcgtaacgctccagacattaacccacgtcaattcaccgctatgatgcgtttggatcac
aaccgtggtttgtctcagctagctgctaagctagacgtaaccttagaagacatcactaag
atgactatttggggtaaccactctgctactcagtacccagatcttttccacactttggtt
aaaggcgacgttgccgttgagcaagtagagaaagattggtacgaaaacgactttattcct
actgttcagcaacgcggtgcagctatcattaaagctcgtggagcgtcttctgctgcgtct
gctgctaacgctgcaattttccatatgcgcgattgggctttgggtacgccagagaacgat
tgggtttctatgggcgtatacagcgatggtagctacggtatagaagaaggtttaatctac
tctttcccatgtgtttgcaaaaacggcgactgggaaattgttcaaggtttaactatcgat
gagttttctcgcgctaaaatgaccgcgactgaaaatgaattaaaagaagagcgcgacgct
gtaaaatctttgttgcctgcttaa

DBGET integrated database retrieval system