KEGG   Saccharophagus degradans: Sde_2106Help
Entry
Sde_2106          CDS       T00335                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sde  Saccharophagus degradans
Pathway
sde00020  Citrate cycle (TCA cycle)
sde00310  Lysine degradation
sde00380  Tryptophan metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Module
sde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sde_2106
  09105 Amino acid metabolism
   00310 Lysine degradation
    Sde_2106
   00380 Tryptophan metabolism
    Sde_2106
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Sde_2106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ABD81366
UniProt: Q21IW3
LinkDB All DBs
Position
complement(2690725..2693586)
Genome map
AA seq 953 aa AA seqDB search
MPCHTVGEMQESIMELLWKTSHLSGGNAAYVEDQYESYLSDPHSVSEEWRDYFDKLPRVN
GSASEDVNHSEIIKYFELLGKNRARPIIVPGAGSGDIAHERKQVEVVQLVNAYRLSGHQK
ANIDPLNLRAVKNPVDLDLGFHRLNTADLDSVFQTGDLAFGYKEAKLKDIIADLEKTYCG
NIGAEVMHITNYEERRWLLNRLERSRSQPDFGPKAKRNILRRLTAAEGLERHLDSKYPGT
KRFGLEGGESFIPLLDALIRRVGEYGAKEMVLGMAHRGRLNALVNILGKNPSDLFDEFEG
KKLVDTSGDVKYHQGFSSNVMTPGGEMHLALAFNPSHLEIVSPVVEGSVRARQDRRGDKD
GHTVVPVVVHGDAAFAGQGVVMETFQMSQTRAYKTGGTVHLVINNQVGFTTSRADDARST
AYCTDVAKMIETPIFHVNGDDPEAVVYVTQLAADYRNEFKKDVVIDLVCYRRRGHNETDE
PSSTQPLMYKAIRSHKTTRTVYAEQLVNAGVVTQDEADQMTNDYRAALDRGEHVARGLVS
EPDSSLFVNWSPYIGHDWNTPADTTYPIKELQSLAEQTSHVPDGVQVQRQVAKIYDDRRK
MAGGALPINWGMAETLAYATLLKEGHKIRLTGQDVGRGTFSHRHAVVHNQKTGEAYIPLA
NISEDQAPLDIYDSLLSEEAVLAFEYGYATTSPKGLVIWEAQFGDFANGAQVVIDQFITS
GEHKWQRLCGLTMLLPHGYEGQGPEHSSARLERFMQLCAEHNIQVCIPTTPAQVYHMIRR
QAIRPMRRPLVVMSPKWILRHKLATSTLEELAEGSFKTVIGDDVVKPEEAKRVILCSGKV
YYHLFEAREEREEKDVALIRIEQLYPFPEEALRVELAKYPGLVDVVWCQEEPQNQGAWYS
SQHRMRRVVERVNEDAELRYVGRASSSAPAAGYMSTHLEEQNKFINAALDTSV
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtcatacggtgggcgaaatgcaagaaagtatcatggagttattgtggaaaacc
tcgcatctatctggaggtaacgccgcatatgtagaagatcagtacgaatcctatctgtca
gaccctcattccgtttcggaagagtggcgcgactacttcgataagttaccccgtgttaac
ggcagcgctagcgaagatgtaaaccattccgaaatcattaagtatttcgagctgctcggt
aaaaaccgcgcgcgtccaataattgtgcccggtgctggtagtggcgatattgcccacgag
cgcaagcaggtagaagttgttcagttggtaaatgcctaccgcttaagcggtcatcaaaaa
gccaatatcgatccgctaaatctacgcgcagttaaaaaccctgttgatttagacttgggc
tttcaccgcttgaatacagccgatttagattctgtattccaaaccggtgacctcgcattt
ggctacaaagaagccaagctgaaagacatcattgcagacctagaaaaaacttactgcggc
aacattggcgcagaagttatgcacattactaactacgaagagcgtcgctggttgttaaac
cgcttagagcgttcgcgttctcagccagatttcggccctaaagctaagcgcaatatcttg
cgtcgtttgactgcagccgaaggcttagagcgtcatttagatagcaaatacccaggtaca
aagcgctttggtttggaagggggcgaaagcttcattccattgcttgatgcgttaattcgt
cgtgttggcgaatacggtgccaaagaaatggtattgggtatggctcaccgtggccgctta
aatgcgctggtgaacattcttggtaaaaacccatctgatttgtttgatgagtttgaaggt
aagaagctagtagatacctctggtgacgttaagtatcaccaaggtttctcgtcaaacgta
atgactcctggtggcgaaatgcaccttgcgttggcgtttaacccatctcacttggaaatt
gtatctccagtggttgaggggtctgtacgtgcacgtcaagatcgccgcggcgacaaagac
ggccacaccgtagtgcctgttgtagtacatggtgatgctgcgtttgctggtcagggcgtt
gtgatggaaacattccaaatgtcacaaacccgcgcatacaaaactggcggtactgtgcac
ttggtaattaacaaccaagtaggtttcactactagccgtgcagacgacgcacgctctaca
gcttactgtaccgacgtggcaaaaatgatcgaaacaccgatcttccacgttaacggtgac
gacccagaagcggttgtttacgttactcaattggcagcagattaccgcaacgaatttaag
aaagatgtggttattgatttggtttgttatcgccgtcgtggccacaacgaaaccgatgag
ccttcatctactcagccgttaatgtacaaggctattcgttcgcacaaaactactcgcact
gtgtatgcagagcagcttgttaacgctggtgtggttactcaagacgaagcggaccagatg
actaacgattatcgtgctgctttggatagaggcgagcacgtagcgcgtggtttggtaagc
gagccggattcttcgctgtttgtaaactggtcgccttatattggtcacgactggaataca
cctgcagatactacgtatccaatcaaagaattgcagtcgttggcagagcaaactagccat
gtgccagatggtgttcaggtacagcgtcaggtagcgaaaatctacgacgaccgtcgcaaa
atggcgggcggtgccttgccaattaactggggcatggccgaaactctggcttacgctacc
ttgttgaaagaaggccataaaattcgtttaacggggcaagatgttggtcgtggtactttc
tcgcatcgccatgctgttgtgcataaccaaaaaactggtgaagcttacattccgttagcg
aatatttcagaagatcaagcgccgttagatatttacgattcgttattatctgaagaagcg
gtgctggcgttcgaatacggttacgcgactacttcgccaaaaggtttggttatttgggag
gctcagttcggtgatttcgccaacggcgctcaagttgttattgaccaatttattacaagt
ggcgagcacaagtggcagcgtttgtgtggcttaactatgctattgccacatggttacgaa
gggcaggggccagagcactcttcagcacgtttagagcgctttatgcaattgtgtgcagag
cacaacattcaagtgtgtatccctaccacgcctgcgcaggtttatcacatgatccgccgt
caggctattcgcccaatgcgcagaccacttgttgtgatgagcccgaaatggattcttcgt
cacaagttggcaacgtctacgttagaagagctagctgaaggtagctttaaaacagtaatt
ggcgatgacgttgttaagccagaagaagccaaacgtgtaattttgtgtagcggtaaggtt
tattaccatcttttcgaggctcgcgaagagcgtgaagagaaagacgttgcattaattcgc
attgagcaactttacccattccccgaagaggcgctgcgcgttgagctagcaaaataccct
ggtttggtggatgtagtgtggtgtcaggaagagccgcaaaaccaaggcgcttggtactct
agccagcaccgcatgcgcagagttgtagaacgagttaacgaagacgcagagttgcgttac
gttggtcgggcatcttcttctgcacctgcagcgggttacatgagcacccacttggaagaa
cagaataagttcatcaacgcggcattggacacttccgtttaa

DBGET integrated database retrieval system