KEGG   Saccharophagus degradans: Sde_2647
Entry
Sde_2647          CDS       T00335                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sde  Saccharophagus degradans
Pathway
sde00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sde_2647
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Sde_2647
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Sde_2647
    1.1.1.-  
     Sde_2647
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C 3HCDH_N AdoHcyase_NAD
Other DBs
NCBI-ProteinID: ABD81907
UniProt: Q21HC2
LinkDB
Position
complement(3348164..3349180)
AA seq 338 aa
MKAAQYAGNKSFNVVDGAKVPPAEGEVCLQVGYTGICGTDMHIYHGVMDQRVSIPQIIGH
EMSGTVVEVGAGVTDYTVGDRVVVRPLDYCGDCPACNAGHSHVCHNLKFMGIDSPGAFQS
YWTVKARTLHALPDNVSLKQGALIEPLSVACHDVARTRLQAGEKALVIGGGPIGQLVALV
AKSVGAEVMISEVSEARLKFAAERGIKTVNPVTDDIEAVVKEWTGGKGADAVFEVSGVAA
AVETMTKVAAVRGRICMVAIHSQKPQVDLFQFFWKELELLGARVYESADFEHAIELVASG
KIDVDSFISSVTSLNDIGTAFASMDNNPAGMKALVECN
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaaagctgcacaatatgcgggaaataaaagttttaacgttgtagatggcgctaaagtg
ccccccgcagaaggcgaggtgtgtctacaggttggttacactggtatatgcggtaccgat
atgcatatttaccacggggttatggatcagcgtgtttctattccacaaattatcggccat
gaaatgtcgggtacggtagtggaagtaggcgcaggggtgaccgactatacagtaggcgac
cgcgtagttgttcggcctttagattactgtggcgattgcccagcgtgtaatgcagggcat
tctcatgtgtgccataacctaaagtttatgggcatagatagcccaggggccttccaaagc
tactggacagttaaagcgcgcacgcttcacgcattgccagacaatgtgagcttaaagcaa
ggtgcactaatcgagccgctgtctgttgcctgtcacgatgtagcgcgcacgcgtttgcaa
gcgggtgaaaaagcattagttattggtggtggcccaatcggtcaactcgtagccttagta
gcaaaaagtgttggcgcagaggtaatgatttctgaggtgagcgaagcgcgcctaaagttt
gccgcagagcgcggtattaaaaccgttaaccccgtaaccgacgatattgaagcggtagta
aaagagtggactggtggtaaaggcgcggacgcagtatttgaagtatctggcgtggctgca
gcagtagaaaccatgaccaaagttgccgcagtgcgtggtcgtatttgtatggtggcaatc
cattcgcaaaagccacaggtagacctgtttcagttcttctggaaagagctagaactgctg
ggcgcgcgagtatacgaatcggcggacttcgagcacgctattgagcttgtggccagcggc
aaaattgatgtggattcatttattagctcggtaaccagtttgaacgatataggtaccgca
tttgccagcatggataacaacccagccggaatgaaagcgttagtggagtgtaattaa

DBGET integrated database retrieval system