KEGG   Saccharophagus degradans: Sde_2647Help
Entry
Sde_2647          CDS       T00335                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
Organism
sde  Saccharophagus degradans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C AdoHcyase_NAD 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABD81907
UniProt: Q21HC2
LinkDB All DBs
Position
complement(3348164..3349180)
Genome map
AA seq 338 aa AA seqDB search
MKAAQYAGNKSFNVVDGAKVPPAEGEVCLQVGYTGICGTDMHIYHGVMDQRVSIPQIIGH
EMSGTVVEVGAGVTDYTVGDRVVVRPLDYCGDCPACNAGHSHVCHNLKFMGIDSPGAFQS
YWTVKARTLHALPDNVSLKQGALIEPLSVACHDVARTRLQAGEKALVIGGGPIGQLVALV
AKSVGAEVMISEVSEARLKFAAERGIKTVNPVTDDIEAVVKEWTGGKGADAVFEVSGVAA
AVETMTKVAAVRGRICMVAIHSQKPQVDLFQFFWKELELLGARVYESADFEHAIELVASG
KIDVDSFISSVTSLNDIGTAFASMDNNPAGMKALVECN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcacaatatgcgggaaataaaagttttaacgttgtagatggcgctaaagtg
ccccccgcagaaggcgaggtgtgtctacaggttggttacactggtatatgcggtaccgat
atgcatatttaccacggggttatggatcagcgtgtttctattccacaaattatcggccat
gaaatgtcgggtacggtagtggaagtaggcgcaggggtgaccgactatacagtaggcgac
cgcgtagttgttcggcctttagattactgtggcgattgcccagcgtgtaatgcagggcat
tctcatgtgtgccataacctaaagtttatgggcatagatagcccaggggccttccaaagc
tactggacagttaaagcgcgcacgcttcacgcattgccagacaatgtgagcttaaagcaa
ggtgcactaatcgagccgctgtctgttgcctgtcacgatgtagcgcgcacgcgtttgcaa
gcgggtgaaaaagcattagttattggtggtggcccaatcggtcaactcgtagccttagta
gcaaaaagtgttggcgcagaggtaatgatttctgaggtgagcgaagcgcgcctaaagttt
gccgcagagcgcggtattaaaaccgttaaccccgtaaccgacgatattgaagcggtagta
aaagagtggactggtggtaaaggcgcggacgcagtatttgaagtatctggcgtggctgca
gcagtagaaaccatgaccaaagttgccgcagtgcgtggtcgtatttgtatggtggcaatc
cattcgcaaaagccacaggtagacctgtttcagttcttctggaaagagctagaactgctg
ggcgcgcgagtatacgaatcggcggacttcgagcacgctattgagcttgtggccagcggc
aaaattgatgtggattcatttattagctcggtaaccagtttgaacgatataggtaccgca
tttgccagcatggataacaacccagccggaatgaaagcgttagtggagtgtaattaa

DBGET integrated database retrieval system