KEGG   Saccharophagus degradans: Sde_2935Help
Entry
Sde_2935          CDS       T00335                                 

Gene name
gal2C
Definition
(GenBank) putative b-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sde  Saccharophagus degradans
Pathway
sde00052  Galactose metabolism
sde00511  Other glycan degradation
sde00600  Sphingolipid metabolism
sde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Sde_2935 (gal2C)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Sde_2935 (gal2C)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sde_2935 (gal2C)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sde_2935 (gal2C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2 Invasin_D3 SspH
Motif
Other DBs
NCBI-ProteinID: ABD82192
UniProt: Q21GI7
LinkDB All DBs
Position
complement(3727209..3729023)
Genome map
AA seq 604 aa AA seqDB search
MDASNNKTGVAIATLTETAVAVPAQKNVTVTANATINNPKLWGPLPTQKPQRYLAVSQIM
QAGIVVDNYQTTFGIRDIAFDPERGVVVNGEPVYIQGVNQHHDLGALGAAFNVRAAERQL
ELLQEMGVNAIRMAHNPPAKELLDLTDKMGFLVIDEIFDSWERKKTPLDFHLIFPEWSEP
DVRNFIRRDRNHPSVIGWSLGNEVGEQYTGEAGAAVAKRLHDIAKSEDPTRPTSVSINFA
KPGMALPPVMDMINLNYQGEGIRNAPEYVHLKGIRTAPLYPKFREAYPNKVIISSENAAA
VSSRGEYFFPVTAGASAPVADGAGGDPNSAHVSAYELYTAPFGSSADKVLGSLADHPYVA
GGFVWSGWDYLGEPTPYYSARSSYFGVIDLAGFKKDRFYLYQAHWRPDLPMAHILPHWNW
PNRVGEVTPVHVFTSGDEAELFLNGKSLGRKIKGKNAFRIRWDNVIYQPGTLKVVAYKNG
KQWAQSVVATTGSASQLQLTGDRTRIRADGKDLAFITVDVQDADATNVPTADNPLSFTLA
GPGEIVATDNGDPTDLTSFTSHTRNAFNGKCLVIVRGVAGKPGALTLNVTGAGLKAAQTV
ITTH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcatccaataataaaaccggtgtagccattgctacgttaaccgaaaccgccgtt
gccgtaccagcgcaaaaaaatgtaacggtaacggctaacgctacaataaataacccaaag
ctttggggcccgttacccacgcaaaaaccgcagcggtatttggccgtatcgcaaataatg
caagcgggtattgttgtagataattaccaaaccactttcggcatacgcgatatagcgttt
gaccccgagcgcggcgtggtggttaacggtgagcctgtttatattcaaggggtaaatcaa
catcacgacttaggtgcgttgggcgcagcatttaatgtgcgtgcagcggagcgccaatta
gagttattgcaggagatgggcgtaaatgccattcgtatggcgcacaacccgccagcgaaa
gagttgctagacctaacagacaaaatgggctttttagttatcgacgaaatattcgactct
tgggagcgcaaaaaaacaccgctcgactttcaccttatatttcccgaatggtcggaacca
gatgtgcgaaattttattcgccgcgatcgcaaccacccatcggtaataggctggagccta
ggcaacgaagtaggcgagcaatataccggcgaagctggcgcagcagttgcaaaacgactg
catgatattgcaaaaagtgaagacccaactcgacccacttcggtttctattaattttgcc
aagccgggtatggcgttgccgccggttatggatatgatcaatttgaattatcaaggcgaa
ggtattcgcaatgcacctgaatacgtgcacttaaaaggtattcgcaccgcgccgctttac
cccaagtttcgcgaggcttatccaaataaagtaataataagtagcgagaacgcggccgca
gtaagttcgcggggggaatacttttttccggtaaccgcaggtgcaagtgcaccagtagca
gatggtgccggtggtgaccctaattctgcgcacgtaagcgcctacgagctgtataccgcg
ccgtttggttcttctgccgataaagtgctgggttcccttgctgatcacccttatgtggct
ggaggttttgtgtggagcggttgggattatttgggcgaacccaccccttactattccgcg
cgcagctcgtattttggtgtaattgatttggcggggtttaaaaaagatcggttttatttg
taccaagcgcactggcgaccagatttacccatggcccatattctgcctcactggaattgg
cccaatcgagttggcgaagtaacacctgtgcatgtatttacatctggggatgaagctgaa
ttattcctaaacggtaaatcgctaggtagaaaaataaaaggcaaaaatgcatttcgcatc
cgttgggacaacgttatttatcagcccggcacattaaaagtggtggcctataaaaatggt
aagcaatgggcgcaatctgttgttgccactactggcagtgctagccaattacagttaacc
ggagatagaaccagaattcgagcggatggcaaagacctcgcgtttataaccgtagatgtg
caagatgccgatgccacaaacgtgcccactgccgataatccattaagctttaccctagct
ggccctggggaaattgtggccacggataacggtgacccgacggatttaacgtcttttact
tcgcatacccgcaatgcttttaacggtaagtgtttggttattgttcgtggtgttgcgggt
aagccgggtgcgcttaccttaaatgttacgggggcagggctaaaagctgcacaaacggta
ataacaactcattaa

DBGET integrated database retrieval system