KEGG   Saccharophagus degradans: Sde_3944Help
Entry
Sde_3944          CDS       T00335                                 

Definition
(GenBank) protein kinase
Organism
sde  Saccharophagus degradans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr dCache_3 CHASE4 HAMP RIO1 APH sCache_3_2 Kinase-like Pkinase_fungal FTA2
Motif
Other DBs
NCBI-ProteinID: ABD83199
UniProt: Q21DN0
LinkDB All DBs
Position
complement(4970268..4972370)
Genome map
AA seq 700 aa AA seqDB search
MSRISQKISFSIRNKIFFLVLIAFSVMIVAISWQIGEQAKRVSTQTVSKSLAQSSVILNT
KIISRFETIRDVAIGLARDGRVLPLVYESESATLQDLSLEFQRALGFNILFFTDASGTIL
ARSDRPEAIGANLAGKGELFDKALTGETSTGIFVSQGKLMQMVVVPVFDNVAQDIIRGTI
ALAYELSQELAQEINALTASEVGFFVFTRNNQREINGVSSTYNTNLVLGNALAQRLTADN
NLWQNIATAGVNFKETQLIIGEEEYLAVTQILGNSTDQPLGFVMVLRSRSELMQPFVAIQ
RRVLIVGGICLLLASVLAWLFALRLSRPIVELVTVTNSIREGQFDAARRKSIGNDEVGLL
YDAVFTMGKSLQEKTELEDYLALVSDELAVNEKINLDAEADGEVTELSEQAPVLTAKKSK
PPLQNIIVDERYKIIEKLGAGAMGTVFLALDIELDEKVAIKMMPKSLIDQHTGINYKEEI
RLARQITHRNILRIFDFGAWKNYYYITMEFISGYDLSDLLRIKGAFESNVGVVMAKQICS
AMNAAHEQGIIHRDLKPTNMIINRQGVLKIMDFGLAMKVGKQDSGEPSKGNTADTKTMVA
GTPRYMAPEQFTDGELDQRTDIYAIGIILYAIFNGKPPFNNKGYEALAKQHFNSPVPEME
GKGAQLSGGLRAIIHKCLAKQPETRYQTVREILDDLAILA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaataagccaaaaaatatcgtttagtattcgcaacaaaatattctttttagtg
cttattgcttttagtgtaatgattgtagccatttcgtggcaaattggtgagcaagcgaag
cgcgtttccacccaaactgtgtctaaatctttggcgcagtcgagtgtaattttaaatact
aaaattattagtcgcttcgaaacaattcgcgatgtggcaataggactagcgcgagatggg
cgcgtactgccattagtgtatgaaagtgaatcggctacgctacaagatttaagcttagaa
tttcagcgtgcattgggctttaatattttatttttcaccgacgctagcggcactatttta
gctaggtcagacaggccagaagcgataggtgcaaacttagcaggcaaaggcgaattgttt
gacaaagccctcactggcgaaaccagcacaggtatttttgtaagccagggtaagttaatg
caaatggtggtagtgccagtatttgataacgtagcccaagatatcattcgcggcaccatc
gccctagcctacgagctttcgcaagagctggcgcaagaaattaacgcactcaccgcaagt
gaagttggcttttttgtatttacccgcaacaaccaaagagaaattaacggggtatccagt
acttataacactaacttagtgctgggcaatgctttggcacaaaggttaaccgcagataat
aacctgtggcaaaacattgccaccgcaggggtaaactttaaagaaacgcaattaattatt
ggcgaagaagaatacttggcggtaactcaaatattaggtaacagcaccgaccagccctta
ggttttgttatggtgttgcgctctcgctcagaactaatgcagccctttgttgcaatacaa
cgtcgtgtattaatagtgggcggcatatgtttgctactggctagtgtgttggcttggttg
tttgccctgcggttaagccgcccaatagtggagttggtaaccgttaccaacagtattcgt
gagggccaattcgacgcagctaggcgcaaatcgataggcaacgacgaggtagggttgctg
tacgatgccgtattcaccatgggtaaatcgctacaggagaaaacagagctggaagactac
ctcgctttagtatccgatgagttagcggttaacgaaaaaattaatttagatgcagaggca
gacggcgaagtaacggagctgtctgaacaagcaccagtgctaaccgcaaaaaaatcaaag
ccgcccttacaaaatattattgttgatgagcgctacaaaattattgaaaaactgggtgcg
ggcgcgatgggcacagtgtttttagcgttagatatagagctagatgaaaaagttgccatc
aaaatgatgccaaaatcattaattgatcagcacacgggtattaattacaaagaagaaatt
cgcttagcgcggcaaatcactcaccgaaatattttaagaattttcgattttggtgcctgg
aagaactattactacatcactatggagtttatttctggctacgatttgagtgatttacta
agaataaaaggcgcgttcgaaagtaatgtgggtgtagttatggccaagcaaatttgttcg
gctatgaatgccgcgcatgagcaaggcattatccaccgcgatttaaaaccaaccaatatg
attataaatcgccaaggtgtgttaaaaataatggattttggtttggcgatgaaggtgggt
aagcaagatagcggtgaaccgagtaagggcaataccgcagacacgaaaacaatggtagca
ggcacaccgcgctatatggcgccagaacaatttaccgatggcgagctggatcaacgcaca
gatatttatgctattggtattatcttatatgccatttttaatggtaagccgccgttcaat
aacaagggttacgaggcgttagcgaaacagcactttaatagccctgtcccagaaatggaa
ggtaaaggagcgcagctttctggtggtttgcgagcaattattcacaagtgtttagctaaa
caaccagaaacacgctatcaaacagtacgcgagattcttgatgacttagcgatactggcc
taa

DBGET integrated database retrieval system