KEGG   Steroidobacter denitrificans: ACG33_00335Help
Entry
ACG33_00335       CDS       T04296                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00071  Fatty acid degradation
sdf00280  Valine, leucine and isoleucine degradation
sdf00281  Geraniol degradation
sdf00310  Lysine degradation
sdf00360  Phenylalanine metabolism
sdf00362  Benzoate degradation
sdf00380  Tryptophan metabolism
sdf00410  beta-Alanine metabolism
sdf00627  Aminobenzoate degradation
sdf00640  Propanoate metabolism
sdf00650  Butanoate metabolism
sdf00903  Limonene and pinene degradation
sdf00930  Caprolactam degradation
sdf01100  Metabolic pathways
sdf01110  Biosynthesis of secondary metabolites
sdf01120  Microbial metabolism in diverse environments
sdf01130  Biosynthesis of antibiotics
sdf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ACG33_00335
   00650 Butanoate metabolism
    ACG33_00335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACG33_00335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACG33_00335
   00310 Lysine degradation
    ACG33_00335
   00360 Phenylalanine metabolism
    ACG33_00335
   00380 Tryptophan metabolism
    ACG33_00335
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACG33_00335
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACG33_00335
   00281 Geraniol degradation
    ACG33_00335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACG33_00335
   00627 Aminobenzoate degradation
    ACG33_00335
   00930 Caprolactam degradation
    ACG33_00335
Enzymes [BR:sdf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACG33_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AMN45574
UniProt: A0A127F549
LinkDB All DBs
Position
85744..86499
Genome map
AA seq 251 aa AA seqDB search
MSEQFTSRIHDNGVAEVVLDRPPVNALNSAGWYALAECIAALGENTAVRVIVIRAQGRGF
CAGVDIKELDADSSLIVAVNAGNYATFKAVHLNKVPVIAAVHGFVLGGGIGVCGAADIVI
AAEDASFGLPEVDRGAMGGAAHLQRMFGVQKTRYLFFTGEMIGAPEAFRLGAIERVVPRE
RLRDEAMAIAAKIAAKSPAMIRIAKEALTGIEDGNLEVKYRWEQGFTLQAYMSPDSAETR
RAFVEKRDTRF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcagttcacgagccggatccatgacaatggtgtggccgaggtggtgctcgat
cgcccgccggtcaacgcactcaattccgccggctggtatgcgctcgccgagtgcatcgcg
gcactcggtgaaaatacggccgtgcgcgtcatcgtcattcgcgcgcaaggtcgaggcttt
tgtgcgggtgtcgacatcaaggaactcgatgccgactccagtctgatcgtggctgtgaat
gccggcaactacgccaccttcaaggcagtgcatctcaacaaggtgccggtgattgcggcg
gtacacggcttcgtgctcggcggcggcatcggcgtctgcggcgcggccgatatcgtcatc
gccgccgaggatgcgagcttcggcctgcccgaggtggatcgcggcgcgatgggcggcgcg
gcgcacctgcagcgcatgttcggcgtacagaagacgcgatacctgtttttcaccggtgaa
atgatcggtgcgccggaagccttccggctcggcgccatcgagcgggtcgtgccgcgcgag
cggctgcgggatgaggcgatggccattgccgccaagatcgccgcgaaaagtccggccatg
atccgtattgccaaggaagcgctcaccggtatcgaggacggcaatctcgaggtaaaatat
cgctgggagcagggatttaccttgcaggcttacatgagcccggactcggcggagacgcgg
cgtgcctttgttgagaaacgcgatacccggttctag

DBGET integrated database retrieval system