KEGG   Steroidobacter denitrificans: ACG33_00870Help
Entry
ACG33_00870       CDS       T04296                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase/alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00500  Starch and sucrose metabolism
sdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACG33_00870
Enzymes [BR:sdf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ACG33_00870
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ACG33_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C GHL5 Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: AMN45680
UniProt: A0A127F7Z9
LinkDB All DBs
Position
213412..216729
Genome map
AA seq 1105 aa AA seqDB search
MSEESLWYKDAVIYQMHVKAFQDANGDGIGDFAGLTQRLDYIQDLGVDTLWLLPFYPSPL
RDDGYDIADYCDVHPDYGTLEDFKEFIAAAHRRGLKIITELVINHTSDQHPWFQLARRSP
PGSAERDFYVWSDDDKKFAGTRIIFTDTEASNWAWDSLAGQYYWHRFFSHQPDLNHNNPR
VVDAVIEVMRFWMNMGVDGMRLDAIPYLCVREGTSNENLPETHAVLKRMRAAMDASYRDR
VFLAEANQWPEDVREYFGDGDECHMAYHFPLMPRIFMAVALEDRYPISEILRQTPDIPEN
CQWAIFLRNHDELTLEMVTDRERDYMYQMYAQEPRMRVNVGIRRRLAPLLGNDTDRIKLM
NSLLLSMPGSPVIYYGDEIGMGDNIYIGDRDGVRTPMQWSIDRNAGFSRADPQRLYLPTI
MDPIYGYQAVNVEAQNRDPSSLLNWTRRILAVRRQYQCFGRGTLDFVRPQNRKLIAYIRS
FDAEIVLCVANLAQTAQAVELDLSKYKGRVPVELMGHNAFPPIGELPYFLTLPAHGFFWL
LLSDTAQPPEWHVERLPATELPVLVLAEGLTTFLVDGARAPSGSGLARRTVQQLEQDVLP
EFLQPRCWFRRSREGFVAAQLGPRSLWRMDQKTFLLSFIEAKSAEEPQRYFLPLTIAWED
DTDGVLRTSDWTLAKVREHARAGVLIDAYADPTFCLGLVRCATENARVPFAGGELHFERC
GNQLSLPPEAEVQALDHAGTVVDHTSIVLHNALFLKAYRRVEIGPHPDVEMGRFLTRAGF
RSSAALCASITYVDTDSTVIAAVFAYIGNQGDAWTYALNHLDRYATDMYSQDVAVESPHA
LFTRQMRTLGRRVGALHALLARAPADDAAFAPEPYEITDLERLCDAICRDARSVLESLSD
KMPALTPALRISAERLLTQRRTLLQCICEMGSVTGGEPLQRFRTRLHGNLRLSKVLLVAD
DLLITGFEGDPTLTLAQRRRKATPLYDVASLLRSFDHARATALERAVTGRPDLSEHLEAA
LLQWREAASEAFLKGYRASMRGVGSVPADKASFMRQLNLLQIGLVTRELLELLSSDPGRI
AAPIDALLELMNKRAGRRIGRQDHR
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaatccctatggtacaaggatgccgtcatttatcagatgcacgtgaaggca
tttcaggatgccaacggtgacggtatcggggattttgccgggctgacccagcggctggac
tatatccaggacctcggagtcgatacgctctggctgctgcccttctatccctcgccgtta
cgtgacgacggatacgacatcgcggattattgcgacgtgcacccggactatggcacgctc
gaggacttcaaggaattcattgccgcagcacatcggcgcggcctgaagataatcaccgaa
ctggtgatcaatcacacctccgatcagcatccgtggttccagctcgcgcgtcgttcgcca
ccgggatccgcagaacgcgacttctacgtatggagcgatgacgacaaaaaatttgccggc
acccgcatcattttcactgataccgaagcctccaactgggcctgggattcacttgccggc
cagtattattggcatcgcttcttttctcatcagccggacctgaatcacaacaatccccgc
gtcgtcgatgccgtcatcgaggtgatgcgcttctggatgaatatgggcgtcgacggcatg
cgcctggatgccataccgtatttgtgtgtgcgtgaaggaaccagcaacgagaatctgccg
gaaacgcatgcggtactgaagcgtatgcgcgcggccatggatgccagttatcgcgaccgc
gtatttctcgccgaggcgaatcagtggccggaagatgtacgcgaatacttcggcgacgga
gacgagtgccacatggcgtatcattttccgctgatgccgcgcattttcatggcggtcgca
ctcgaggatcgttatccgatctcggagatcctgcgtcagacgcccgatattcccgaaaat
tgccagtgggccattttcctgcgcaaccacgacgaactcacgctggaaatggtgacggat
cgcgagcgcgactatatgtaccagatgtatgcacaggagccacgcatgcgtgtcaatgtc
ggcatacgccggcgcctggcaccgctgctcggcaatgatacagatcgcatcaagctgatg
aacagcctgttgctgtccatgccagggtcgcccgtcatctactacggcgacgaaatcggc
atgggcgacaacatctatatcggggatcgcgacggcgtacgcactcccatgcaatggagt
atcgatcgcaacgcaggcttttcgcgcgccgatccgcagcggctctatttgccgaccatc
atggatccgatctacggctaccaggccgtcaatgtagaggctcagaatcgcgatccttct
tccttgctgaactggacgcggcgcattctggctgtgcgtcgccagtaccagtgcttcggc
cgcggtacactggatttcgtccgtccgcagaaccgcaagctgatcgcctacatccgcagc
ttcgatgccgagatcgtattgtgtgtcgccaaccttgcacagacggcacaggccgtggag
ctcgatctatcgaaatacaagggcagggtaccggtcgagctgatgggccataatgccttc
ccgccgatcggtgagctgccttacttcctgaccttgccggctcacggttttttctggctg
ctactgagcgataccgcgcagccgccagagtggcatgtggagcgcctgccggccacggaa
ttgccggtactcgtgctcgccgaaggactgacgacattcctggtagacggcgcacgagcg
ccgagcggcagcggtctggcgcgtcgaacggtgcaacagctggaacaggatgtgctgccc
gagtttttgcagccgcgatgctggttcaggcgttcgcgggagggctttgttgctgcgcag
ctcggtcctcgcagcttgtggcgcatggaccagaagacctttctattatcgttcatcgaa
gcgaaatccgccgaggagccgcagcgttattttctgcctttgacgattgcgtgggaagac
gacaccgacggtgttttgcgcacctccgattggacgcttgcgaaagttagggaacacgcc
cgtgcgggcgtgctgattgacgcatacgccgaccctacgttctgcctcggcttggtgcgc
tgtgccacagagaacgcgcgtgtgccatttgccggaggtgaattgcacttcgagcgctgc
ggaaatcagctatcactcccgccggaagcagaagtacaggcactcgatcatgccggcacc
gtggttgaccacaccagcatcgtattgcacaacgcgctgtttctcaaagcgtaccgacgc
gtcgaaatcgggccgcatcccgatgtggaaatgggaaggtttttgacgcgtgccggtttt
cgttccagcgccgcgctgtgcgccagtatcacctatgtcgatacggattccaccgtgatc
gccgctgtgttcgcatatataggcaatcagggagatgcatggacttacgcgctcaatcac
ctggatcgctatgcgaccgacatgtattcgcaggatgttgccgtcgagtctccgcatgca
ctgttcacccgccagatgcgtacgctggggcggcgcgtcggcgccctgcatgcgctgctg
gcgcgggcgcctgcggacgatgcggcatttgcgccggaaccctacgaaattaccgatctg
gagcgcctttgcgatgccatctgccgggatgccagatcggtgctggaatcgctgtccgat
aaaatgccggcattgacgccggcgttgcgcatatctgccgagagacttttgacgcagcgc
agaaccttgctgcaatgtatatgtgaaatgggaagcgtgaccggcggcgaaccgcttcag
aggttccggacacgcctgcatggcaatttacggctgagcaaggtgctactcgtggccgac
gatcttttgatcaccggattcgagggtgatccgacgcttacgctggcgcagcgccgtcgc
aaggctacgcctctgtatgacgtggccagtctgctgcgctccttcgatcacgcgcgcgcc
accgcgctggagcgcgcggtgaccgggcggccggatctttccgagcatctggaagcagcc
ttgctgcagtggcgtgaggcggccagcgaagcttttctcaaggggtatcgcgccagcatg
aggggcgtcggcagcgtaccggcggataaagcttcgttcatgcggcagctgaatttattg
cagatcggccttgtgacgcgtgaattgctcgaattactgagcagcgatcccggacgtatc
gccgcgccgatcgatgcgctgctggaattgatgaacaaacgggccgggaggcggattggc
cggcaggatcaccggtag

DBGET integrated database retrieval system