KEGG   Steroidobacter denitrificans: ACG33_02485Help
Entry
ACG33_02485       CDS       T04296                                 

Definition
(GenBank) cystathionine beta-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00260  Glycine, serine and threonine metabolism
sdf00270  Cysteine and methionine metabolism
sdf00450  Selenocompound metabolism
sdf01100  Metabolic pathways
sdf01130  Biosynthesis of antibiotics
sdf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACG33_02485
   00270 Cysteine and methionine metabolism
    ACG33_02485
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACG33_02485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdf04147]
    ACG33_02485
Enzymes [BR:sdf01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     ACG33_02485
Exosome [BR:sdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACG33_02485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 DUF2378
Motif
Other DBs
NCBI-ProteinID: AMN45995
UniProt: A0A127F8R5
LinkDB All DBs
Position
586686..587894
Genome map
AA seq 402 aa AA seqDB search
MSFKSTDTFTSTSKPASGLRFSTRCIHAGQAPDPATGAVMPPIYTTSTYAQSSPGVHQGY
EYSRTANPTRGAWERCIADLEGGTHGFAFASGMAATATLLELIDGGSHIVAMDDLYGGTF
RLFERVRRRTANLEITFADLAQPGALEAAVRADTRMIWMESPTNPLLRLVDIAAVSAFAR
RQGILTVVDNTFASPWVQRPLELGADIVMHSATKYLNGHSDMIGGVAVTGDAALAEQIGF
LQNAVGAVSGPFDSFLALRGLKTLALRMRQASESALRIADWLQAQPKVARVLYPGLPSHP
QHALAKRQMRNGFSGIVTFFIKGGLDEARSFLEHCRLFTIAESLGGVESLVDHPGLMTHA
SIPPDKRQALGIDDTLIRLSVGIEDVEDLIEDLRNALGNVRD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaatcgaccgacacgtttacctctacgtccaagccggcatccggcctgcgt
ttttcgacgcgctgcattcacgcgggacaggcgccggatcccgccaccggggcggtgatg
ccgccgatttatacgacctccacctatgcgcagagcagcccgggcgtgcaccagggctac
gaatattcgcgcaccgcgaatccgacccgcggcgcctgggagcgttgtatcgctgatctt
gaaggcggcacgcatggcttcgcctttgcgtcggggatggcggcgacggcgaccttgctg
gaactgatcgatgggggcagccacatcgtggcgatggatgatctgtacggcggtacgttc
cgtttgttcgagcgggtacgccggcgtacggccaatctggagatcaccttcgcggacctg
gcgcagccgggggcgctggaggctgcagtgcgtgccgatacgcgcatgatctggatggag
tcaccgaccaatcccttgctgcggctggtggatatcgccgccgtctcggcgttcgctcgc
cggcagggtatcttgactgtggtcgacaataccttcgcgagcccctgggtgcagcgcccg
ctggagttgggtgcggacatcgtcatgcactcggcgaccaagtacctgaatgggcattcg
gacatgatcggcggggtggcggtgaccggcgatgccgcgttggcggagcagatcggtttc
ctgcagaacgcggtcggcgcggtgagcgggccgttcgacagttttctggccttgcgggga
ctgaagaccttggcgctgcgcatgcgccaggccagcgagagcgccctgcgcatcgcggac
tggctgcaggcgcagccgaaggtggcgcgggttctatacccggggctgcccagccatccg
caacacgcgctggcaaagcgtcagatgcgcaacggtttcagcggcatcgtgacgtttttt
atcaagggtggcctggatgaggcgcgcagcttcctggagcattgccggctgttcacaatc
gcggaaagcctgggcggcgtggaaagtctggtcgatcatccggggctgatgacgcatgcg
tccatcccgccggacaagcgccaggcactgggcatcgacgatacgctgatccgcctgtcg
gtcggtatcgaggacgtggaggatctgatcgaggatctgcgcaatgccttgggtaatgtc
cgggattaa

DBGET integrated database retrieval system