KEGG   Steroidobacter denitrificans: ACG33_02870
Entry
ACG33_02870       CDS       T04296                                 

Definition
(GenBank) 23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
sdf  Steroidobacter denitrificans
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sdf03009]
    ACG33_02870
Enzymes [BR:sdf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     ACG33_02870
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     ACG33_02870
Ribosome biogenesis [BR:sdf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ACG33_02870
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_23
Other DBs
NCBI-ProteinID: AMN46068
UniProt: A0A127F8Y5
LinkDB
Position
670761..673121
AA seq 786 aa
MQFFASCPPGVADLTAAELRECGAARTREFKLGVQFDGELESAYRACLWSRTASRVLLPL
GTFPAATAEALYEGVGSIDWGGHLDAAGSLAIEFGGASSGITHTHYGALKVKDAIVDQFR
ARTGQRPSIDLDRPDIRIDVRLDRERATVSLDLSGESLHRRGYRVRGVAAPLKENLAAAM
LMRCGWPAMVALAASTAVPVGAEPGMQSGSAPLPLPDGGGSDLAFVDPLCGSGTLVIEAA
LIALDIAPGLLRRRFGFTGWRGHDRVLWQRLVEEARARRTAGRTHRIGLYGYDSDAGAVR
AANENVERAGLRDVVRIERRELARLVRESGAAQGLLATNPPYGERIGEQAQLQPLYETLG
RQLREHFEGWKAAVLTGNPPLAKAIGIEARRTHTLFNGRIECRLLRFDVLPAQYRSREKS
ATPLEEILARPGAQMFANRLSKNLKTMGDWARRESIDCFRIYDADMPEYAFAIDWYGDGE
GNRWAVAQEYAPPRTVQPQAARQRRQEALAVISRVLDIPAERLFVRERRRQKDGAQYEKV
AHEREFEIVREQPYRFAVNFSDYLDTGLFLDHRLTRRYLGALARGKRFLNLFAYTGAATV
YAVGGGAVASTTVDMSHTYLDWARRNLALNGLTGPAHEFIQADCMAWLAQQSESSPWKRP
RSTHTDPWARAQLRYGSQSGDESKFQERVQQWDLMFIDPPTHSRSKRMEGDFDVQRDHVE
LLRMAANLLAPDGVIVFSNNYSRFRLDAQALAGFDIEDIGPKTLPRDFARNPRIHSCHIL
RFHSVK
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgcaattctttgcttcctgtccccccggcgttgccgatctgaccgccgcggaactgcgc
gagtgcggcgcggctcgcacgcgcgagttcaagctgggtgtgcaattcgacggagaactg
gagagcgcctatcgtgcctgcctgtggtcacgcaccgcgagccgcgtgctgttgccgctc
gggacctttcccgccgcgaccgcagaggctctttacgagggtgtggggtcgatcgattgg
ggcgggcatctcgatgctgccggcagcttggcgatcgaattcggtggtgcctccagcggt
attacgcatacacattacggcgcattgaaggtcaaggatgcgatcgtggatcagttccgg
gcccgtacggggcagcgtccatcgatcgatctcgatcggccggacatccgcatcgacgta
cgtctggatcgcgaacgcgcgactgtcagcctggatttgtcaggtgagagcctgcatcgg
cgcggctaccgcgtgcgcggcgtggcggcacccctgaaggagaatctggcggctgccatg
ctgatgcgttgcggctggccggcgatggtggcgctggcggcgagtacagcggtgccggtt
ggcgcggagccgggcatgcagtcaggatctgctcccttgccgctaccggacggtggagga
tcggacctggctttcgtcgatcctctgtgcggctcgggcaccctggtgatcgaggcggcg
ctgatcgcattggacatcgccccgggcttgttgcgccggcgtttcggcttcaccggctgg
cgcgggcatgaccgggtgctgtggcagcgtttggtcgaggaggcgcgcgcgcgacgcacg
gccggccgtacgcatcgtatcggcttgtatggctacgacagcgatgccggtgcggtccgg
gcggcgaacgagaatgtcgaacgggccgggttgcgcgacgtggtgcgcatcgagcgccgc
gaactggcgcgcctggtccgggagagtggggcggcgcagggactgttggcgaccaacccg
ccctatggcgagcgcatcggcgagcaggcgcaactgcagccgttgtacgaaaccttgggc
agacagctgcgtgaacatttcgagggctggaaggccgccgtgctgacgggcaatccaccc
ctggcgaaggcgatcggtatcgaggcgcggcgcacccataccttgttcaatggacgtatc
gaatgccggctgctgcgtttcgatgtcctgccggcacagtaccgttcgcgcgagaagtcc
gcaacgccgctggaggagattctggcgcggccgggtgcacaaatgttcgcgaaccgtctg
agcaagaatctcaagacgatgggcgattgggcacgccgcgaatcgatcgattgcttccgc
atctacgacgccgacatgccggaatatgccttcgcgatcgattggtacggggatggtgag
ggcaaccgatgggccgttgcgcaggaatatgcgccgccccggacggtccagccgcaggct
gcgcgccagcgtcgccaggaagcgctggcggtgatatcgagggtactggacattcccgcc
gaacggctcttcgtgcgtgaacggcgccgccagaaggatggtgcgcaatatgagaaagtc
gcacacgaacgcgaattcgagatcgttcgtgaacagccctatcgatttgcggtcaatttc
agtgattatctcgataccggcctgttcctggatcatcggctcacgcggcgttatctcgga
gcgctggcgcgcggaaagcgcttcctgaatttattcgcttacaccggcgcagcgacggta
tatgccgtcggcggcggcgccgtggcctccacgacggtggatatgtcgcatacctacctg
gactgggccaggcgcaatctggcgctcaacggcctgaccggccccgcacatgagtttata
caggccgactgtatggcctggctggcgcagcagagcgagtcttccccctggaaacggccg
cgatccacgcatacggatccctgggcccgagcgcaacttcggtatgggtcgcagtctggc
gacgaatcgaaattccaggagagggtgcagcaatgggatcttatgttcatcgatccgcca
acccactcgcgttccaagcgtatggaaggtgacttcgatgtccagcgtgaccatgtagag
ctgctgaggatggcggctaatctgctggcaccggacggcgtcattgtattttccaataat
tattcccgctttcggctggatgcgcaggcgcttgccggcttcgatatcgaggatatcggt
cccaagaccctgccgcgcgacttcgcgcgcaatccccgcatccattcctgccatatcctg
cgttttcactcggtgaaatga

DBGET integrated database retrieval system