KEGG   Steroidobacter denitrificans: ACG33_06730Help
Entry
ACG33_06730       CDS       T04296                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sdf  Steroidobacter denitrificans
Pathway
sdf00550  Peptidoglycan biosynthesis
sdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACG33_06730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sdf01002]
    ACG33_06730
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdf01011]
    ACG33_06730
Enzymes [BR:sdf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ACG33_06730
Peptidases [BR:sdf01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ACG33_06730
Peptidoglycan biosynthesis and degradation proteins [BR:sdf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ACG33_06730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AMN46797
UniProt: A0A127F8Q7
LinkDB All DBs
Position
1494884..1495672
Genome map
AA seq 262 aa AA seqDB search
MVLGSRVAAAEPLDPWPRVASAYLVVADGELLWARNADAIRPPASLAKLMTALVLLAHDW
DPDATIITSRTAAGIEGSRLGLRAGERLRAGDAFTALLVRSANDACVALAEHMAGSLAAF
AALMNARAAAMGLQESHFVHPCGLDAPGQGSSARDLLQVAAEAMQLSEVARAVALTDAVV
TTLDGRRLFMHTGNHLLGRTRGVEGIKSGYTGKAGKCLIALAHRDGHAVWLVMLNAPERW
FTAQGMIDAAFARVADREGRGE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ctggtgctcggtagcagggtagcagcggccgagccactcgacccatggcctcgcgtcgcc
tccgcctacctcgtcgtggctgatggcgaactgctgtgggcacgcaacgcggatgctatc
cgcccgccggcctctctcgccaagctgatgaccgcgctggtgctgctcgcgcacgactgg
gatccggatgccacgatcatcaccagccgcaccgccgctggcatcgagggttcgcgcctg
ggtttacgtgcgggcgagcgattgcgcgccggtgatgcctttacggccttactggtgcgt
tcggccaacgatgcctgcgtggcgctggcagagcatatggctgggtcgctggcggccttt
gccgccctgatgaatgccagagcagccgcgatgggattgcaggagtcgcacttcgtgcat
ccctgcggcctggatgcacccgggcagggcagttcggctcgtgacttgctgcaggtcgcc
gcagaggccatgcaattgtctgaagtggcgcgcgcggtagcgctcacggatgccgttgtc
acgaccctcgacgggcgacgcctgttcatgcatacgggcaaccatctgctgggccgcact
cgcggtgtagaaggcatcaagagcggctacaccggcaaggccggcaaatgcctcatcgcg
ctggcgcaccgcgacggacatgcggtgtggctggtgatgctgaatgcgcccgagcgctgg
ttcacagcccagggcatgatcgatgcagcctttgcaagagttgccgatcgcgagggcagg
ggggaatga

DBGET integrated database retrieval system