KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_02755Help
Entry
SDE12394_02755    CDS       T02017                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00500  Starch and sucrose metabolism
sdg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDE12394_02755
Enzymes [BR:sdg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SDE12394_02755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADX24083
LinkDB All DBs
Position
531212..532675
Genome map
AA seq 487 aa AA seqDB search
MTNQLIMQAFEWYLPADGNHWKTVKASIPQLQHLGVTELWLPPAFKGTGINDVGYGVYDL
FDLGEFDQNGTVITKYGSKQEYLDLITALKEAAIKPIADIVLNHKANGDHKERFFVIKMN
PENRQEALTEPYEIEGWTGFDFPGRNGCYNDFKWHWYHFTGLDYDAKNNETGIYMITGDN
KGWANNDLIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFVNDIRTQIKPDLEVFGEYWKSDQDSMEDYLEATNEQFALVDVGLHMSFFNASH
QGKDFDLTHIFEGSLVASRPDLAITFVENHDTQRGQALESTVEDWFKPLAYGLILLRQEG
KPCLFYGDYYGISGDFAQASFKEVLDKLTLLRKEAVYGEQVDYFDHANCIAWTCLGDEEH
PHPLAVILSNGDEGWKHVEIGQDFVGQTFVDYLGHCSEKVVVAEDGWLDIKVETGSISAW
VPEERSF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaactaatcatgcaggcttttgagtggtatcttcctgcagatggtaaccac
tggaaaacagtgaaagcaagtattccacaattacagcatttaggagtgactgagctctgg
cttcctcctgcttttaaaggaactggtattaatgatgtgggatatggtgtttatgattta
tttgacctaggggaatttgatcaaaatggcacagtcattaccaaatacggtagtaaacaa
gaatatctcgaccttattacagctttgaaagaagctgccatcaaaccaatcgcagatatt
gttcttaaccataaagccaatggagatcataaggaacgtttttttgtcatcaaaatgaat
cctgaaaatcgccaggaagctctgacagaaccttatgagattgaaggctggactggtttt
gactttcctggtcgaaatggttgctataatgattttaaatggcattggtatcatttcaca
gggcttgattatgatgccaagaacaatgaaactggcatttacatgattacaggtgacaat
aagggctgggccaacaatgacttgattgatgacgaacatggtaattttgattacctcatg
tacaatgatttggacttcaaacacccagaggttattcaaaacttgcaggattgggctaag
tggtttattgagacaacaggaatcgaaggttttcgtctagatgccgtcaaacacattgat
tcttattttatccaaacctttgtcaatgatattcgcactcaaatcaaaccagatttagaa
gtttttggtgagtattggaagtcagaccaagactccatggaagactacttggaagccacc
aatgaacagtttgctttagtagatgtcggtcttcacatgtctttctttaacgccagtcat
caaggaaaggattttgatttaacacatatctttgaaggaagtttagtggctagcaggcct
gacttggctattacttttgttgaaaatcatgacacgcaacgtggtcaagctttggagtcc
acagtggaagattggtttaaacctctggcctacggcttaattctcttgcgccaagaaggc
aaaccttgtctgttctatggcgattattatggtatttccggagactttgctcaagctagt
tttaaagaagtgcttgacaagttgacgctgttgcgtaaagaggctgtttacggggaacaa
gtcgattattttgatcacgctaattgcattgcttggacttgtttaggcgatgaagaacat
ccccatccgctggcagttatcctatcaaatggtgatgaaggttggaagcatgtggaaatc
ggtcaagactttgtcgggcagacctttgtcgattacttaggccattgttcagaaaaggta
gtggtggctgaagatggttggcttgatattaaggtggagacaggctctatttcagcctgg
gtacctgaagaaagaagcttttaa

DBGET integrated database retrieval system