KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_03325Help
Entry
SDE12394_03325    CDS       T02017                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00620  Pyruvate metabolism
sdg00680  Methane metabolism
sdg01100  Metabolic pathways
sdg01120  Microbial metabolism in diverse environments
sdg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDE12394_03325
  Energy metabolism
   00680 Methane metabolism
    SDE12394_03325
Enzymes [BR:sdg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SDE12394_03325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADX24188
LinkDB All DBs
Position
632904..635669
Genome map
AA seq 921 aa AA seqDB search
MSLKKLESSNNQAIIAEEVAILKDMLEKITRRMIGDEAFATIETIVALSEKQDYVGLETI
IASISNQDMDVISRYFSILPLLINISEDVDLAYEINYQNNANKDYLGKLALTIDAVAEKE
NAKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHDLLRKYRDVKAGVVNQEKWHNELYR
YIEIIMQTDIIREKKLKVKNEITNVMQYYNGSLIQAVTKLTTEYKNLAQKRGLDLINPNP
ITMGMWIGGDRDGNPFVTAETLRLSATVQSEVILNYYIEKLAALYRTFSLSSTLIQPSAE
VERLASLSQDQSIYRENEPYRRAFHYVKSRLVQTRTQLTGDQDTTGQSLTADRLTRQLAM
QDQLEGPIAAYVSPEDFKADLMAIEQSLLSNGDVALVDGDLREVMQAVDIFGFFLASIDM
RQDSSVQEACVAELLKGANIVEDYSSLSETEKCDLLVKQLTEDPRTLSSAAVAKSDLLEK
ELAIYAAARELKDKLGDEVIKQHIISHTESVSDMFELAIMLKEVGLIDQHKARVQIVPLF
ETIEDLDNARDIMTTYLSYDMVKSWIAANHNYQEIMLGYSDSNKDGGYLASGWTLYKAQN
ELTAIGEENGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYG
NKDVAYYHLEMLISASINRMVTQMLTNPNEIDGFREVMDGIVADSNKIYRQLVFDNPHFY
DYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFK
HYIDQAEGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLADSQEVRDVFHV
ILDEWQLTKNVILAIEGHEELLEDNPSLKQSLAFRLPYFNVLNYIQIELIKRLRNHQLRE
EDEKLIHTTINGIATGLRNSG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacttaaaaagctagagagtagtaacaaccaagctattattgctgaggaagttgct
attttaaaagatatgttggaaaaaatcacccgtcgaatgattggagatgaggcgttcgca
acgattgaaaccattgttgctttatctgaaaagcaagattacgttgggttagaaacgatt
atcgcaagcatttctaatcaagatatggatgtgatttcaagatacttttcaatcttgcct
ctgttaattaacatttcagaagatgtggatttggcttatgaaatcaattatcaaaataat
gccaacaaggattatttaggcaaacttgccttaactattgatgccgtcgcagaaaaagag
aatgccaaagacatcttagagcaggttaatgtggtacctgttttgacagcccatccgaca
caagtgcagcgcaagaccattttggagttgacaacgcatatccatgatctccttcgtaag
tatcgtgatgtcaaagctggtgtcgttaaccaagagaagtggcataatgaactctatcgg
tacatagaaatcattatgcagacagatattatccgcgagaaaaaactcaaggtcaaaaat
gagattactaacgtcatgcagtattacaatggttctctcattcaagcagtgaccaaatta
acaactgagtataaaaacttggctcagaaacgtggcttagacttgatcaatcctaacccc
ataaccatgggcatgtggattggaggagatagggatgggaatccttttgtcacagctgaa
accctaaggttatctgctacggttcagagcgaagtcatcctgaattattatattgaaaaa
ttagcagccctttaccgaaccttttctttgtcgtctaccttaattcaaccgagtgcagaa
gtagagcgtctggctagcttatcccaagaccagtctatttaccgtgaaaatgaaccttac
cgtagggcttttcattatgtgaagtcccgccttgtccaaacacgcactcaattgacaggg
gaccaagataccactggacagtcgctcacagcggatcgccttactcgtcagttagcaatg
caagatcagttagaaggacctattgctgcctacgtttcgccggaagactttaaagctgat
ttgatggccattgagcaatctcttttaagcaatggtgatgttgcactggttgatggagac
ttacgcgaagtgatgcaagctgttgatatttttggcttcttcctagcaagtattgacatg
aggcaagactctagtgtgcaagaagcatgtgtggcagagttattaaaaggagctaatatc
gttgaggattatagctcactttcagaaactgaaaaatgtgatcttcttgtgaaacaactg
acagaggatccaagaacactatcttcagcagcagttgctaagtcagatttgctcgaaaaa
gaattagcgatttacgcagctgcacgtgagttgaaggataagctaggtgacgaggtcatt
aagcagcacatcatttcgcacacagaaagtgtttctgatatgtttgaattggccatcatg
ctcaaagaagttggtctgattgaccaacacaaagctcgtgtgcaaattgtgccacttttt
gaaactattgaagacttagacaatgctcgtgacattatgacaacttacttgagttatgat
atggttaaatcatggattgcagctaatcataactatcaagaaattatgttaggttattct
gacagtaataaagatggtggttaccttgcttcaggttggaccctctataaagctcaaaat
gaattaacagccattggagaggaaaatggcgtgaaaatcactttcttccatggtcgtgga
ggaacagttggacgaggcggtggaccttcttacgatgccatcacctcacaaccttttggt
tctattaaagatcgcattcgcctcactgaacaaggggagattattgaaaataaatatggt
aataaagatgtcgcttattaccatttagaaatgctcatttcagcttctattaatcgtatg
gtcacacaaatgcttaccaaccctaatgaaattgacggattcagagaagtcatggatggt
attgttgcggacagtaataagatttaccgccagctagtatttgataatcctcatttttac
gattatttctttgaagcaagtcctatcaaggaagtttctagccttaacatagggtcaaga
ccggcagcccgtaaaacgattacggaaatcacaggcttgcgggctattccttgggtcttt
tcgtggtcacaaaatcgtatcatgttccccggatggtatggggtaggatcggcctttaaa
cattatattgaccaagcagaaggcaatcttgagcgtctccaacacatgtaccagacttgg
cccttcttccattccttattatcgaatgtggatatggtgctatcgaaatcaaatatgaac
atcgcttttcaatatgctcagttggcagacagccaagaggttagggatgtttttcatgtg
attttggacgaatggcagttgacaaaaaatgtgattcttgccatcgaaggacatgaggag
ttactagaagataacccatctttgaaacaaagtttagcttttcgtctcccttatttcaat
gtgttgaactatattcaaattgaattgattaagcgcctgcgcaatcatcagttaagagaa
gaggatgaaaaattaattcacacaacgattaatggaattgcgactgggttacgtaattca
ggctaa

DBGET integrated database retrieval system