KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_09140Help
Entry
SDE12394_09140    CDS       T02017                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00220  Arginine biosynthesis
sdg00250  Alanine, aspartate and glutamate metabolism
sdg00290  Valine, leucine and isoleucine biosynthesis
sdg01100  Metabolic pathways
sdg01110  Biosynthesis of secondary metabolites
sdg01130  Biosynthesis of antibiotics
sdg01210  2-Oxocarboxylic acid metabolism
sdg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SDE12394_09140
   00290 Valine, leucine and isoleucine biosynthesis
    SDE12394_09140
   00220 Arginine biosynthesis
    SDE12394_09140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdg01007]
    SDE12394_09140
Enzymes [BR:sdg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SDE12394_09140
    2.6.1.66  valine---pyruvate transaminase
     SDE12394_09140
Amino acid related enzymes [BR:sdg01007]
 Aminotransferase (transaminase)
  Class I
   SDE12394_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADX25262
LinkDB All DBs
Position
complement(1796346..1797560)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPEVDIEDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEADWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEVLEDIVALAREHQLIIFADEIYDRLVMDGEEHVAIASLAPDVFCLSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIHEAINAIPGLSAVKPKAGLYLFPKIDRNMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPTVEELEDVQEKITRVLHQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgtcgcctacgacattcgaggtcct
gttttagacgaggccaaccgtatgattgctaacggtgaaaaaatccttcgattaaacacc
ggtaacccagcggcttttgggtttgaggctcctgatgaggtcatccgtgatttgattgtc
aatgcgaggcttagtgaagggtattcagatagcaagggtatcttttctgcccgcaaagcc
attatgcaatattgtcagctgaaaggtttcccggaggtagatattgaggatatttatttg
ggaaatggggtgtcagaattaatttccatgtcattacaagccctgcttgatgatggggat
gaggtgttggttcctatgccagattaccctctatggacagcctgtgtcagtctgggtggt
ggcaaagctgtgcattacttgtgtgatgaagaagcggattggtatcctgacattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaaccctaacaatccc
actggtgccctttaccctaaagaagtcctagaagatattgttgcccttgcaagagagcac
cagctgattatttttgccgatgaaatctatgaccgattggttatggacggagaggagcat
gttgccattgctagtttagcgccagatgtattttgtttatccatgaatggcttatcaaaa
tcccatcgtattgctggtttccgagtaggttggatggtcttatctgggccaaaagatcac
gtgaaaggctatatcgaaggattgaatatgctagcgaatatgcgcctctgctccaatgtg
ttggcccaacaggtagtgcaaacatctctaggcggtcgtcagtctgttgatgagctcttg
ttgccaggtggacgtatttttgagcaacgtaattttatccatgaagccatcaatgcgatt
ccaggcttatctgcagttaaacccaaagcaggtctttacctttttcctaagattgatcgt
aatatgtatcgtatcgatgatgatgaagaatttgtgctccaattattaaaacaagaaaag
gtgatgttggttcatggccgaggcttcaactggaaggacccagaccacttccgaattgtg
tacttaccaaccgtggaagaattagaagatgttcaggaaaaaatcacccgcgtcttacat
cagtacaaacgctaa

DBGET integrated database retrieval system