KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_10365Help
Entry
SDE12394_10365    CDS       T02017                                 

Definition
(GenBank) putative NADH oxidase/alkyl hydroperoxidase reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Brite
KEGG Orthology (KO) [BR:sdg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SDE12394_10365
Enzymes [BR:sdg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SDE12394_10365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored Thioredoxin_3 GIDA Thi4 HI0933_like Glutaredoxin FAD_binding_3 DAO AlaDh_PNT_C Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADX25485
LinkDB All DBs
Position
2035367..2036899
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLESDLVLQAYLGDDEQSQKVKDFVEEIAAMSDRISVEETVLDR
KPSFKVAKKGQDSGVAFAGLPLGHEFTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPLSEEAFADKGVYDVLVVGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAADTANMTIIKNVATKDIVGDDHVTGLNY
TERDSGEDKHIDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccttgttagaatct
gacctggttttgcaagcttatcttggtgatgacgaacagtctcaaaaggttaaagacttc
gtggaagaaattgctgcgatgtctgatcgtatttcggttgaagaaactgtcttagaccgt
aaaccaagctttaaagttgcgaaaaaaggacaagatagtggggttgcctttgctggtcta
cctttaggccacgaatttacgtctttcatccttgccctcttgcaagtatctggacgtgct
ccaaaagtagatcaagatgttattgaccgcatcaaggctattgatcgcccactgcatttt
gaaacctacgtcagcttaacctgccataactgtccagacgttgttcaagctctcaacatt
atgtctgttttgaatgacaagatttcacatactatggtggaaggtggcatgttccaagat
gaagtgaaagcaaaaggcattatgtctgtaccaactgtcttcttagatggtgaagaattc
acttcaggccgtgctactatcgaacaactcttagaacaagtcgctggtcccctttcagaa
gaagcctttgcggataaaggggtctatgatgtccttgttgttggtggtggacctgcgggc
aatagcgctgctatctatgcagcccgtaaaggattgaaaacaggtttattggctgagacc
tttggtggtcaggtcatggaaactgtcggcatcgaaaatatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtagaggcccataccaagtcttacgatgtggacatt
atcaaagcacaactagctacttctatcgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctattttagctctcggtgccaaatggcgtaac
atcaatgttcctggagaagatgaattccgtaataaaggggtgacttactgccctcactgt
gatggtcctctctttgaaggcaaggacgttgctgttatcggtggtggaaactctggatta
gaagctgcccttgatttggctggtcttgctaaacacgtttacgtgttagaattcttgcct
gagctcaaagctgacaaagtgcttcaagaccgcgcagctgatactgctaacatgactatt
atcaaaaatgttgctactaaagacattgttggtgacgatcatgttactggtctcaactac
actgaacgtgatagcggtgaagacaaacacattgaccttgaaggggtctttgtccaaatt
ggtcttgttccaaatacagcttggctcaaggatagcggtgtgaacctaaccgaccgcggt
gaaattatcgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttcaatgggatctggggctactgccgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system