KEGG   Spiroplasma diminutum: SDIMI_v3c06880Help
Entry
SDIMI_v3c06880    CDS       T02741                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sdi  Spiroplasma diminutum
Brite
KEGG Orthology (KO) [BR:sdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdi01001]
    SDIMI_v3c06880
Enzymes [BR:sdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SDIMI_v3c06880
Protein kinases [BR:sdi01001]
 Serine/threonine kinases: Other
  Bacterial family
   SDIMI_v3c06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Haspin_kinase FTA2 APH
Motif
Other DBs
NCBI-GeneID: 16854035
NCBI-ProteinID: AGR42392
UniProt: S5M2S9
LinkDB All DBs
Position
complement(765043..766053)
Genome map
AA seq 336 aa AA seqDB search
MNNYQQGSLINERYEVINQLGKGGMASVFKAYDLITKTIVAVKVVAPEIVLKPVGQERFE
IEKEAFAKLGSNPHVVKLFDIIQNGDEWFIILECVEGGTLKDKFQDFGSMTLKELKYYFS
KICDALSEAHKLKIIHRDIKPDNVLLTQSGEVKLGDFGISVMEGISTEVNKAIGTPKYMP
PEIIAAQNPSPQSDIYSLGIMLYEFATGTAPFIAKEAQKIAAKHLKETPTSPKLINPSIP
QSLENLIMKMIEKEPGNRFESVDEVKSELLKIKLSDSPKPYIYHKKVTINMNEGKRTIKV
GTAYDKLPFIARTKFFITFGIILIALIIFLVAMLVV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaataattaccaacaaggatcgttaatcaatgaaagatatgaagtaattaatcagcta
ggaaaaggtggaatggcatctgtttttaaagcatatgatttaattactaaaactattgtg
gcagttaaagttgtagctccagaaatagttttaaaaccagtgggacaagagagatttgaa
attgaaaaggaagcatttgcaaaactaggatcaaatccacatgttgtaaaactgtttgat
attattcaaaatggagatgaatgatttataatattggaatgtgttgagggtgggacatta
aaagataaatttcaggattttggttctatgacattaaaagaacttaaatattatttttca
aaaatttgtgatgcattatctgaagcacataaattgaaaataattcatagagatataaaa
ccagataatgttttattaacacaatcaggtgaagtaaaattaggagactttggtatttca
gttatggaaggtatttcaacagaagttaataaagctattggtactccaaaatatatgccc
cctgaaataattgcagctcaaaatccatctcctcaaagtgatatatattctttaggaatt
atgctttatgaatttgcaacaggaacagcaccgttcattgccaaagaagctcaaaaaatt
gctgcaaaacatttaaaagaaactccaacaagtccaaaactaattaatccatcaattcca
caaagtttggaaaatttaattatgaaaatgatagaaaaagaacctggtaatagatttgaa
tcagtggatgaagttaaaagtgagcttttgaaaattaagttatcagatagtccaaaacct
tatatttatcataaaaaggtaacaataaatatgaatgaaggtaaaagaacaattaaagtg
ggaacagcttatgataaattaccatttattgcaagaaccaaattctttattacttttgga
atcattttaattgccttaataatatttttagttgctatgttggtagtataa

DBGET integrated database retrieval system