KEGG   Sulfurospirillum deleyianum: Sdel_0378Help
Entry
Sdel_0378         CDS       T01126                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sdl  Sulfurospirillum deleyianum
Brite
Enzymes [BR:sdl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sdel_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACZ11415
UniProt: D1AZE8
LinkDB All DBs
Position
363577..364173
Genome map
AA seq 198 aa AA seqDB search
MAITLPPLPYEASALEPYISANTLGYHHGKHHQTYVNNLNNLIQSTPLADEALEAIIFAS
ANVPEKVGIFNNAAQVWNHTFYWSCMKKGGGGVPSGAVAAKIIEDFGSFEAFIEAFKNAG
LTQFGSGWAWLVLDNGKLKITKTSNADTPMVHQQKALLTVDVWEHAYYLDYQNKRADYID
IFLKHLVNWDFVNANLKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcgattactttaccaccacttccgtacgaagcaagtgcccttgagccttatatcagt
gcgaatacattgggttatcatcatggaaagcaccatcaaacgtatgtgaacaatcttaat
aatttgattcaaagtacacctttggcagatgaagcgttggaagcgattatttttgcctca
gcgaatgtacctgaaaaagtaggtatttttaacaatgcggcgcaagtttggaatcacacc
ttctactggagttgtatgaaaaaaggtggcggtggcgtaccaagtggtgctgttgctgca
aaaataatagaagattttggtagttttgaagcctttatcgaagcctttaaaaatgcgggg
cttacccaatttggtagtggttgggcatggttagtcttagacaatggaaaactaaaaatt
actaaaacgagtaacgctgataccccaatggtgcatcagcaaaaagcacttttaaccgtg
gatgtttgggagcatgcgtattatttggattaccaaaacaaacgggcagattatattgat
atttttctcaaacatttagtgaattgggattttgtcaacgccaatttaaaagcgtaa

DBGET integrated database retrieval system