KEGG   Sulfurospirillum deleyianum: Sdel_1050Help
Entry
Sdel_1050         CDS       T01126                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00473  D-Alanine metabolism
sdl00550  Peptidoglycan biosynthesis
sdl01100  Metabolic pathways
sdl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sdel_1050
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sdel_1050
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Sdel_1050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdl01011]
    Sdel_1050
Enzymes [BR:sdl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sdel_1050
Peptidoglycan biosynthesis and degradation proteins [BR:sdl01011]
 Precursor biosynthesis
  Amino acid ligase
   Sdel_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACZ12075
UniProt: D1B1V5
LinkDB All DBs
Position
complement(1068274..1069308)
Genome map
AA seq 344 aa AA seqDB search
MKIAVLFGAQSFEHEISVVSAIALKKVLKSEIVYIFCDYERNFYLIPTDKITSKRFSSGE
YKKDKALHVKQGGFYAKKMLGEEQISFDVMINLVHGRDGEDGKLSALLDFFGIPYIGPRM
EACSISYNKLFTKLYAKEVGVNVLPYQLLHKGSNEAISIAYPFIVKPLRLGSSIGIGIVK
EEKELAYALDVAFEFDDTVLIEPFISGVKEYNLAGCKTDSFTFSIIEEPQKEAFLDFDKK
YLDFSRTKRVNEASLEVTLEKEIQTSFIKLYDPLFLGALIRCDFFVIDGVVYLNEINPVP
GSMANYLFDDFDGVIKRLVNYLPHTTTVTKEYRYINSIQAAKGK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagccgttttatttggcgcacagagttttgaacatgagattagcgtggtaagt
gctattgccttaaaaaaagttttaaagagtgaaattgtctacattttttgtgattatgaa
cgtaacttttatttaatacccacagataaaatcacctctaaacgctttagcagtggcgag
tataaaaaagataaagctttacatgtaaagcaaggtggcttttacgctaaaaaaatgctt
ggagaagagcagattagctttgatgtaatgatcaatctggtacatggaagagatggcgaa
gatggaaaattaagtgcactgcttgatttctttggtattccttacattggtcctcgtatg
gaagcatgtagcatcagttacaataaactttttacaaagctctatgccaaagaagtgggt
gtcaatgttttgccatatcaacttttgcataaagggagcaacgaggcgatttctattgcg
tatccctttattgtgaagcctttacgtttaggaagttccattgggattggcattgtcaag
gaagaaaaagagttggcttatgcgctcgatgttgcctttgaatttgatgatacggtttta
attgagccttttatcagtggggtgaaagagtacaaccttgcaggatgtaaaacagatagt
tttacattttccattattgaagagcctcaaaaagaggcgtttttagattttgataaaaaa
taccttgatttttcacgtaccaaaagagttaatgaagcatcccttgaggtaactttggaa
aaagagattcaaacttcatttataaagctgtatgatcctctctttttaggagctttgatt
cgttgtgatttttttgtgattgatggtgtggtctatctcaatgaaatcaatcctgttcca
ggaagcatggcaaattacctttttgatgattttgatggagtgattaagcgtttggtcaat
tatctgccacatacgacaaccgttaccaaagagtaccgttatatcaattcaatacaagcg
gcaaaaggcaaataa

DBGET integrated database retrieval system