KEGG   Shewanella denitrificans: Sden_0248Help
Entry
Sden_0248         CDS       T00344                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00620  Pyruvate metabolism
sdn00680  Methane metabolism
sdn01100  Metabolic pathways
sdn01120  Microbial metabolism in diverse environments
sdn01200  Carbon metabolism
Module
sdn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sden_0248
  09102 Energy metabolism
   00680 Methane metabolism
    Sden_0248
Enzymes [BR:sdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sden_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DnaT EcoR124_C
Motif
Other DBs
NCBI-ProteinID: ABE53544
UniProt: Q12SN2
LinkDB All DBs
Position
complement(283213..285876)
Genome map
AA seq 887 aa AA seqDB search
MSVQSKAEDATDVYASLRANVGQLGQILGDTMRSHLGDAFLEKVEQIRILAKKSRQGDDG
AREQMLALLTALPDEELIPFAKAFNQFLNLANIAEQFHTISRNCDELVCVPDPVEQLLGR
LLKHDLDKSQLHQCLTELDIDLVLTAHPTEISRRTLIQKYASVVDCLTSLENPLLTEREH
SQLQLRLRQLIAQIWHTNEIRHERPTPVDEARWGLSTIETSLWQAVPDFLRQLNDQFEQK
TGLQLAKDVSPVRFSSWMGGDRDGNPFVTARVTQEVLDRNRHAAARLYLKDIVTLMNELS
MEEANAELKALTNNSNEPYRDVLKGLRQKLRNTIDYLNERLEGHQPDIDFNSIIWEQSDL
QAPLECLYQSLCDSGMRLIAHGLLLDILRRLACFGIHMLKLDIRQDAERHSDVIAELTRY
LGLGDYHHWDEDEKQAFLLRELTNRRPLLPPNWKPSPDVAEVLSTCALISKQSPKALGSY
VISMASKPSDVLTVLLLLKESGCTYPMRVVPLFETLKDLTGAAACIKELLQIDWYRGYTK
GMQEVMIGYSDSAKDAGVMAAAWAQYRAQEELVAVCKQAGVKLTLFHGRGGTVGRGGGPA
HQAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVMEATLMPPPEPKKA
WRECMQAIADESVLAYRGIVREEPDFVAYFRAATPEVELGKLPLGSRPAKRKVGGGIESL
RAIPWIFAWSQNRLMLPAWLGAGEALSSAIEQSQLNLLQEMEREWPFFETRISMLEMVYT
KAEPNLARYYERCLVPTELHHLGDKLRARLQLGIDTVLSLTQSDELMSHTPWSRESVKLR
NPYIDPLNFLQTELLARTRNEDQASEKVQLALMLTIAGVAAGMRNTG
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacagagtaaagctgaggatgcaaccgatgtgtatgcatctttgcgcgccaat
gtcggtcagcttggacagattttaggcgataccatgcgcagtcacttaggcgacgcattt
cttgaaaaagtagaacaaattcgtattctcgccaaaaagtcacgtcaaggggacgatggc
gccagggagcaaatgcttgccctgttaaccgccttgcccgatgaagaattaatccccttt
gctaaggccttcaatcaatttttaaacttagccaatattgccgaacaatttcataccatt
agccgtaattgtgatgagctagtctgtgtgcccgaccctgttgagcaattgcttggccga
ttactcaagcatgacttagacaagtcgcaattacaccaatgtctaactgaactggatatc
gatctggtgctgacggctcacccaactgagatatcaagacgcaccctgatccaaaaatat
gcctcagtggtggattgcctgacgtctttagaaaacccgctgctcacagagcgtgagcac
agccagctgcaattgcgtctgcgccagcttattgcgcaaatttggcataccaacgaaatt
cgccatgaaagacccaccccagttgatgaagcgcgctggggccttagcaccatagagaca
tcattatggcaagcggtacctgattttttacgtcaactgaacgatcaattcgagcagaaa
accggtctgcaactggctaaagatgtgtcgccagtgcgtttttctagctggatgggcgga
gatagagatggcaaccctttcgtcacggcccgtgtcacccaagaagtattagacagaaac
cgccacgccgcggctcgcctgtaccttaaagacatagtcaccttgatgaatgagctgtcc
atggaggaggccaatgccgaacttaaggcgctcaccaataacagcaatgagccttatcga
gatgtgctcaaaggcctgcgacagaaactgcgtaataccatagattacctaaacgagcgc
ttagaaggtcatcagccagacatagatttcaatagcattatctgggagcagagcgatctt
caggcgccccttgaatgcttataccaaagcctatgtgactcaggcatgcgtttgattgcc
catggtctgttattggatattctgcgcagactcgcctgctttggcatacacatgctcaag
ctggatattcgtcaagacgccgaacgccacagtgatgttatcgccgagctgacccgctat
ttaggccttggggattaccatcattgggatgaagacgaaaaacaagccttcttactcaga
gagctcactaatcgcagacccctgttaccccccaactggaaacctagccctgatgtagcc
gaagtacttagcacttgtgcgcttatcagcaaacaatcgcctaaagcactgggttcttac
gtcatctctatggccagtaagccatcagatgtattgactgtgctcttgctattgaaagag
tctggctgtacttaccctatgcgcgtcgtgcccttatttgagaccttaaaagatctcaca
ggggccgcggcttgtattaaagaattgctgcaaatcgactggtatcgcggttataccaaa
ggcatgcaggaagtgatgattggctattcagactcggctaaagatgctggagtaatggct
gcggcttgggctcaatatcgcgctcaggaagaactggttgccgtctgtaaacaggctggg
gtcaaactgaccttattccatggccgtggcggcacagtgggtcgtggcggcggccctgct
catcaggcgattttatcccagccacctggctcggtggatggtcgcatccgcgtaaccgag
caaggggagatgatccgctttaagtttggcttacctaaacttgcggtgcaaagcctagcg
ctttatacctcagcggtaatggaagccacccttatgccgcctccagagccaaagaaagcc
tggcgcgagtgtatgcaagccatcgccgatgaatctgtgcttgcctatcgcggtatcgtt
cgagaagagcctgactttgtcgcttactttagagcggctacacccgaagttgagctgggt
aaattgccattaggcagtcgtccagctaagcgtaaagtcggtggcggcatagaaagctta
cgtgctatcccatggatttttgcttggtcgcagaaccgactcatgctccctgcttggctt
ggcgccggtgaggctctgagctcggccattgaacaaagtcagctcaatttattgcaagaa
atggagcgtgagtggccattctttgaaacccgtatttccatgttagaaatggtctatacc
aaggctgagccgaatttagctcgctactacgagcgttgcttagtgccaactgagttacat
catctcggagataaactcagagcgagactgcaactcggtatagatactgtgttatcactg
actcagtctgatgagttgatgtcacacacgccttggagccgcgaatccgttaagcttcgc
aatccttatatcgatccattaaacttcctgcaaactgaattattggcacgtacccgcaat
gaagatcaggcatcagaaaaggttcaattggccttgatgctgaccatagcaggcgttgct
gcaggcatgagaaataccggatga

DBGET integrated database retrieval system