KEGG   Shewanella denitrificans: Sden_0351
Entry
Sden_0351         CDS       T00344                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00300  Lysine biosynthesis
sdn00550  Peptidoglycan biosynthesis
sdn01100  Metabolic pathways
sdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Sden_0351
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sden_0351
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sden_0351
Enzymes [BR:sdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Sden_0351
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: ABE53646
UniProt: Q12SD0
LinkDB
Position
391611..392984
AA seq 457 aa
MIELTLDALAQKLNAKHLGENLTIANVSTDSRAIPAACLFVALKGERFDAHDFAATAIEN
GAKALLVERELALDIPQLIVANSQKAMGEIGALVRDIVSPICVALTGSNGKTSVKEMLAS
ILSQGHQVLYTAGNFNNEIGVPLTLLRLSQADEYGVFELGANHKGEIDYTSSLVRPRVAL
VNNIGSAHLEGFGSIEGIAEAKSEIFNHLSADGVAVINADDAFCELMKTKAKAFKQLSFS
REANTNADIQATGLNMNAAGCYGFTIHYQGQQLAVQLPLAGIHQVSNALAASAMCLALGI
SLTDIVSGLARLAPVKGRMQPHTLGRLLVIDDSYNANPSSVSAAIDWLKNRDGFCCLVLG
DLGELGDNAAHLHAQVGQQAKEAQIDALFCCGSLSENTSLAFGSPHYAELPALLVELTSA
IKANRGAVTVLVKGSRSARMERVVENLLNAYEHGELA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatcgaattaaccttggacgcattagcccaaaagttaaatgccaagcaccttggagaa
aacctcaccatagccaatgtgagcacagacagccgcgcaatacccgcagcctgtttattt
gtggcactcaaaggtgagcgtttcgatgcccatgattttgccgccacggccatagaaaat
ggtgccaaggccttgttggtggagcgcgagcttgcgctggatattcctcagctcatagtg
gcaaatagccaaaaagccatgggtgaaatcggcgcgctagtgcgagatattgtctcgcca
atatgcgtggcgctgaccggctcaaacggtaagacaagtgtaaaagaaatgcttgccagt
attttatctcaagggcatcaagtgctttacaccgccggtaattttaataatgaaatcggt
gtgccgttaaccttattgcgattaagccaagctgatgaatacggagtatttgagctggga
gctaatcacaagggcgaaatcgattacacctcttcattagtgcgcccgagagtcgcctta
gtgaacaacattggcagtgctcatttagaaggctttggctccatagaagggatagccgag
gctaagtctgagatatttaatcacctaagtgccgatggtgtagcagtcattaatgccgat
gatgcattttgtgagctaatgaaaaccaaggccaaggcgtttaagcagttgagtttttcc
cgtgaagctaatactaacgcagacattcaagccactgggcttaacatgaatgctgcgggc
tgctatggctttactattcactatcaagggcagcagttggctgtgcaattgcctttggcc
ggtattcatcaggtcagtaatgcactggcagccagtgccatgtgtttagccttaggcatt
agcttaactgacatcgttagtggcctggcaaggcttgcaccagtgaaaggccggatgcag
cctcataccttagggcgcctgctggtcatagatgacagttataacgctaaccctagttct
gtcagcgccgccatcgactggcttaaaaatcgtgacggtttttgttgtttagtgctggga
gatttgggcgaattaggcgacaatgcggcccatttacatgcacaagtcggccaacaagca
aaagaggcacaaatcgatgcgctattttgctgtggcagcttgagtgaaaataccagttta
gcctttggcagcccgcattatgctgagctgcctgctttgcttgtggaattaacctcggcg
attaaggccaatcgcggcgctgtgactgtgttagtcaagggctctcgcagtgcgcgcatg
gaaagagtggtagagaatttattaaatgcttacgagcatggggagttagcgtag

DBGET integrated database retrieval system