KEGG   Shewanella denitrificans: Sden_0352
Entry
Sden_0352         CDS       T00344                                 

Definition
(GenBank) Phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00550  Peptidoglycan biosynthesis
sdn01100  Metabolic pathways
sdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sden_0352
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sden_0352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
    Sden_0352
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     Sden_0352
Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
 Precursor biosynthesis
  Glycosyltransferase
   Sden_0352
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1 Ndc1_Nup
Other DBs
NCBI-ProteinID: ABE53647
UniProt: Q12SC9
LinkDB
Position
392985..394067
AA seq 360 aa
MLVYLAEYLTQFHTGFHVFSYVTFRAILGLLTALVFSLWCGPKLIRRLQLLQIGQVVRND
GPESHFSKRGTPTMGGLLILAGIFVSVLLWGDLESRYVLVMLFVLGSFGTIGFIDDYRKV
VRKDTKGLIARWKYILQSLAALVVAVFLYSSSTLPGETQLVVPFFKDVMPQLGLVFIVLA
YFTIVGASNAVNLTDGLDGLAIMPTVMVAGAFALIAYLSGHVQFANYLHIPHLPEAGELV
IVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIAVLVRQEILLVIMGGVFVME
TVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLGLATLKLR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctggtttatctagccgaatatttaacccaatttcatacagggtttcatgtgttttct
tatgtgacatttcgcgccatcttgggcttgttgactgcattggtgtttagcctatggtgt
ggtcctaaacttatccgccgtctgcagttattgcagattggacaagtggtgcgtaatgac
ggccctgagtcacatttttctaaacgtggtacgccgaccatgggcggcttgctgatccta
gcgggcatctttgttagcgtcttgttgtggggcgatcttgagagccgctacgtgctggta
atgctgtttgtgctgggtagcttcggcactattggttttatcgatgattatcgaaaagtg
gtgcgtaaagacacgaaaggcttaattgcccgttggaaatacattctgcagtctttggcg
gcgcttgtggttgctgtgttcttgtacagcagttcaaccttgccaggtgaaacgcaactt
gtggtaccgtttttcaaagatgtgatgccgcaattgggcttggtcttcatcgtgctggct
tatttcaccattgttggcgccagtaatgcggtgaacctgaccgatgggctggacggttta
gcgattatgcccactgtgatggtggctggtgcgtttgcactgatcgcgtatttatcgggt
cacgtacagttcgccaattatctgcatattcctcatctgcctgaagcgggtgagctggtg
atagtctgcaccgccattgtgggagcaggtcttgggtttctttggtttaacacttaccca
gcgcaggttttcatgggtgatgtggggtcactggccttgggcgccgcattaggtgctatc
gcggtattagtgcgtcaggaaattctattggtgatcatgggcggggtattcgtgatggaa
accgtgtctgtgatcttgcaggtgggttcatacaagttgcgtggtcagcgtattttccgc
atggcgccaattcatcaccactatgagcttaaaggttggccagagccacgggtaatcgtg
cgcttttggattatttcattgtttttagtgttacttggccttgccacgttgaagttaagg
taa

DBGET integrated database retrieval system