KEGG   Shewanella denitrificans: Sden_0355
Entry
Sden_0355         CDS       T00344                                 

Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00550  Peptidoglycan biosynthesis
sdn01100  Metabolic pathways
sdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sden_0355
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sden_0355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
    Sden_0355
Enzymes [BR:sdn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Sden_0355
Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
 Precursor biosynthesis
  Glycosyltransferase
   Sden_0355
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Other DBs
NCBI-ProteinID: ABE53650
UniProt: Q12SC6
LinkDB
Position
396600..397700
AA seq 366 aa
MTVNPMAPRILIMAGGTGGHVFPALAVAKNLAEKGWQVRWLGTADRMEARLVPQHGFDID
FIDIQGVRGNGLLRTLAAPFKIMRSIMQAREVIAEFKPQVILGMGGFASGPGGVAGRLAG
IPLVLHEQNAIPGMTNKLLARIATKVLCAFPNTFALAGQSVQVVGNPVREELALLGSMKQ
QGQHDALKVLVVGGSLGAKVLNEVMPNVVAQLSRSLSITVWHQVGKNNLASTKACYQQMG
QAVNVNVAEFIDDMEAAYRWADVVVCRSGALTVSELAAVGLPSILVPYPHAVDDHQTVNA
AILVDAGAGFLLPQAILTSDNLAEKLSLFANNPEVLVQMGKQAREVAVLDATNKVAEICA
ELARKS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgacagtcaatcccatggcgccgagaattttaatcatggctggcggtacaggtggtcat
gtttttccagccttagccgttgccaagaatctagccgaaaaaggctggcaagtacgctgg
ttaggcacagctgacagaatggaagctcgcctagtacctcagcatggctttgatattgat
tttatcgacatccaaggggtgcgtggtaatggtttactgcgtactttagccgcgcctttt
aaaatcatgcgctctatcatgcaggcccgtgaagtgattgccgagtttaagccgcaggtt
attttgggcatgggcggttttgccagtggtccagggggggtagccgggcgtttagctggt
attcctttagtcttgcatgagcaaaatgccattccgggtatgaccaataagttgttggcg
cgtatcgccactaaggtattgtgcgccttccccaatacgtttgcgttagcgggccagagt
gtacaagtggtcggcaatcccgttagggaagagttggcactcttgggtagcatgaagcag
caagggcaacatgatgcgttaaaagtgcttgtagtcggtggtagtttgggggctaaggta
ctcaatgaagtaatgcctaacgtcgtggctcagctgagccgcagcctgtcgattaccgtc
tggcaccaagttggaaaaaacaatttagcgtccactaaagcctgttaccagcagatgggg
caggccgtcaatgtgaatgtagccgagtttattgatgatatggaagcggcttatcgttgg
gctgatgtggtagtgtgccgctcaggagccttgactgtgtctgagcttgctgccgtgggg
ttgccgagtatcttggtgccttatccccatgcggtggacgaccaccaaactgtcaatgcc
gccattctagtggacgcaggcgcgggctttttattacctcaagccatattaaccagtgac
aatttagctgaaaagctgagcttattcgccaataaccctgaggtattggtgcagatgggc
aaacaagctagagaggttgccgtgttagatgcaaccaataaagtggccgagatttgtgcc
gaacttgcgagaaagagttga

DBGET integrated database retrieval system