KEGG   Shewanella denitrificans: Sden_0522
Entry
Sden_0522         CDS       T00344                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00473  D-Alanine metabolism
sdn01100  Metabolic pathways
sdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sden_0522
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sden_0522
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
    Sden_0522
Enzymes [BR:sdn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Sden_0522
Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
 Precursor biosynthesis
  Racemase
   Sden_0522
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Other DBs
NCBI-ProteinID: ABE53814
UniProt: Q12RW2
LinkDB
Position
591695..592786
AA seq 363 aa
MKPFPRAEISRKALQANLARIRELAPQSKIMAVVKANGYGHGLLNVANSVATYDQGADGF
GLARLEEALELRSGGVNARLLLLEGFFRVTDLPLLVQHHIDTVVHHESQVEMLEQAELTT
PVTVWMKIDTGMHRLGFSLAQFDAIYQRLLACHNIAKPIHLMTHFACSDEPDNSFTQAQI
DAFESVTASLDGDRSLANSGGMLFWPQSQRDWIRAGIALYGVSPMVGDKGGNHGLVPAME
LKSQLISVKDHQAGDSVGYGAFWRARKDTRIGVVAIGYGDGYPRHAPEGTPVWLNGRRVP
IVGRVSMDMLTVDLGLDSQDKVGDEVLLWGSALAVEEVADHIGTIAYELVTKLTPRVAVA
LLP
NT seq 1092 nt   +upstreamnt  +downstreamnt
ttgaaaccttttccccgcgcagaaatcagccgcaaggcattgcaagctaacttggctcgc
attcgagaattagccccgcagagtaaaatcatggctgtggtgaaggcgaatggctatggc
catggtttattgaatgtggctaacagtgtggccacttatgatcaaggcgccgatggtttc
ggcttggcgcgattggaagaagccttagagcttagaagtggcggcgttaatgcaaggcta
ttgttactcgaaggcttttttagggtcacagacttacccttattggtgcaacatcatatc
gatactgtggtgcaccacgaatcacaagtggagatgttagagcaggctgaactcactacg
ccggttaccgtatggatgaaaatcgatactggcatgcacaggttaggctttagtttggct
cagtttgacgccatttatcagcgcttgctggcatgtcacaacatcgctaagccgatacac
ttgatgacgcactttgcttgttcggatgagcctgataacagttttactcaagcgcaaatc
gatgcatttgaaagcgtgacagcctcccttgacggggacagaagtcttgccaactctgga
ggaatgcttttttggcctcagagtcaacgagactggatccgtgctggtatcgcactctat
ggggtgtcgcctatggtgggggataaaggcggtaatcatggtttagtgccagcaatggag
cttaagtctcagttgatttcggtcaaagatcatcaggcgggtgacagtgtcggttatggg
gctttttggcgagcccgcaaagatacccgcatcggcgtggtcgccataggttatggcgat
ggctacccaagacatgccccagagggcacgcctgtgtggctcaatggccgcagggtgcct
atcgttggccgcgtgtctatggatatgttaaccgttgatttaggtttagattcccaagat
aaagtgggtgatgaagttctactctggggtagcgcactggcggtggaagaagtggcagac
catattggcaccatagcctatgagttagtcaccaagttaacccctagggttgcagtagcc
ttactgccttag

DBGET integrated database retrieval system