KEGG   Shewanella denitrificans: Sden_1639Help
Entry
Sden_1639         CDS       T00344                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sdn  Shewanella denitrificans
Brite
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sden_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABE54923
UniProt: Q12NQ3
LinkDB All DBs
Position
complement(1904190..1904774)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEFHYGKHHNTYVVKLNGLVEGTEFANKTLEEVVKTS
SGGMFNNAAQVWNHTFYWNCLAPNAGGPATGAIAAAITASFGSFEEFQAKFTDSAINNFG
SAWTWLVKKADGSLAIVNTSNAATPLTDESVTPLMTVDVWEHAYYVDYRNARPEYLAHFW
QLVNWEFVNANFAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattaccagcattaccctatgcaaagaacgcactcgaaccacacatttca
caagaaacgattgagtttcactatggaaaacaccacaacacttatgttgttaagcttaac
ggcctagttgaaggtactgaatttgctaacaaaactcttgaagaagtcgttaaaacttca
tcaggcggcatgttcaacaacgctgcacaagtgtggaaccacaccttctactggaactgc
ctagcccctaacgcaggtggcccagcaactggcgctatcgcagcggctatcacagcttct
tttggttctttcgaagaattccaagctaagttcactgactctgccatcaataacttcggc
agcgcttggacatggctagtgaagaaagccgatggttctttagctattgttaacaccagc
aacgctgctacgccgctaactgacgagtctgtgactccgttgatgacagttgacgtgtgg
gaacatgcttattatgttgattaccgtaacgctcgccctgaataccttgcccatttctgg
caattggtaaactgggaatttgtgaacgcaaacttcgcagcatga

DBGET integrated database retrieval system