KEGG   Shewanella denitrificans: Sden_2117Help
Entry
Sden_2117         CDS       T00344                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sdn  Shewanella denitrificans
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sdn01002]
    Sden_2117
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdn04147]
    Sden_2117
   04090 CD Molecules [BR:sdn04090]
    Sden_2117
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Sden_2117
Peptidases [BR:sdn01002]
 Metallo Peptidases
  Family M2
   Sden_2117
Exosome [BR:sdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sden_2117
CD molecules [BR:sdn04090]
 Proteins
  Sden_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 LPAM_2
Motif
Other DBs
NCBI-ProteinID: ABE55399
UniProt: Q12MC7
LinkDB All DBs
Position
2514456..2516294
Genome map
AA seq 612 aa AA seqDB search
MKLPFKQPSQIALVVSVALGLSACGQQIKPVATAPAVDAKAAAEFVNDAEVKLEALSIEA
SRAEWIYSNFITEDTAALSAAMGEKTTSMSVQLATQAATFAGLKLDPVVARKLNSLRSSL
ILPAPLDPAKNAELAKISSELNGLYGKGKYCFASGECMTQTELSALMAESKDPQLLLEAW
QGWRQIAKPMRSLFQREVELANEGARDLGFADLSELWRSQYDMKPQEFSNELDRLWGEIK
PLYDSLHCYVRGELNEQYGDEVAPKTGPIPAHLLGNMWAQHWGTIYNSVAPKDADPGFDV
TELLAKNGYDEVKMVKQAESFFTSLGFDALPETFWSRSLFVQPKDRDVVCHASAWDLDNQ
DDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKNQPYIFKGSANDGFHEAIGDTIALSIT
PKYLQQIGLLETVPDASKDIGLLLQQALNKIAFMPFGLMIDQWRWQVFNGQIKPEDYNKA
WWDLREKYQGVKAPIERTEADFDPGAKYHVPGNVPYTRYFLAHVLQFQFHKALCDIAGDT
GPVHRCSIYGNKEAGAKLNQMLEMGASKPWPEALEVVTGTQQMDAKAVLDYFAPLQTWLN
EQNTQAQRQCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccttttaaacagccatctcaaatcgctttagtcgtctctgtggcgctcgga
ttaagcgcatgcggccagcaaattaagccggttgccacggcgcctgctgtggatgcgaag
gcagctgctgaatttgtcaatgatgcggaagtgaaactggaagcattgtccattgaagcc
agccgcgccgagtggatctacagtaactttattaccgaagacacggcggcactttctgct
gccatgggcgaaaaaaccacctcaatgtctgttcagctagcaacccaagcggcaacattt
gcaggcttgaaacttgatcctgtggttgctcgcaagcttaattcgcttcgtagcagtttg
attttgccggcgccgctggatcctgctaaaaatgctgaacttgccaagataagctcagag
ctcaatggcctgtacggtaaaggcaaatactgttttgcctctggcgaatgcatgactcaa
actgagttgtcggcgcttatggcggaatccaaagatccacagctgttattggaagcttgg
caaggttggcgtcaaatcgccaaacctatgcgttcattattccaacgtgaagtagaatta
gctaacgaaggtgcccgtgacttaggcttcgccgatttatctgaattgtggcgcagccag
tacgacatgaagccgcaagaattctccaacgaattagaccgtctatggggtgaaattaag
cccttgtacgattcgctgcattgttatgtgcgcggcgagctgaatgagcaatacggcgat
gaagtggcacctaaaacaggcccaatcccagcacacctcctaggtaatatgtgggcgcag
cattggggcaccatctacaatagtgttgcaccaaaagatgcggacccaggttttgatgtc
actgaattattagctaaaaatggctacgatgaagtcaagatggtcaaacaagccgaaagc
ttcttcacctcccttggttttgatgcattaccggagacattctggagccgctcactgttt
gtgcagcctaaagatagagatgtggtgtgtcatgcatcggcgtgggatctggacaaccaa
gatgatatccgcatcaagatgtgtatccagaaaactgctgaagactttactgttattcac
catgaactggggcataacttctaccaaagagcctataaaaaccagccttacatttttaaa
ggctctgccaatgatggtttccatgaagccattggtgacaccatagcactgtcaatcaca
cctaagtacctgcagcaaattggcctgcttgagactgtgcctgatgcttctaaagacata
ggcctcttgctgcaacaagcattaaataaaattgccttcatgccgtttggtttaatgata
gatcagtggcgctggcaggtctttaacggccaaattaagcctgaagattacaataaagcc
tggtgggacttaagagaaaaataccaaggtgttaaagcccctatcgagcgcactgaagcc
gactttgacccaggtgctaaataccatgtgccaggtaacgtaccttacacacgttatttc
ttagcccatgtgttgcagttccagttccataaagccctttgtgatatcgccggggacaca
ggtcctgtgcatcgctgcagtatttatggcaacaaagaagccggcgctaagcttaaccaa
atgctagaaatgggtgccagcaagccttggccagaagcgttagaagtggtcacaggtact
cagcagatggatgctaaagccgtgttagattactttgcgccgctgcaaacttggttaaac
gagcaaaacacgcaagcccaacgtcaatgtggctggtag

DBGET integrated database retrieval system