KEGG   Shewanella denitrificans: Sden_2354Help
Entry
Sden_2354         CDS       T00344                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00473  D-Alanine metabolism
sdn00550  Peptidoglycan biosynthesis
sdn01100  Metabolic pathways
sdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sden_2354
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sden_2354
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Sden_2354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
    Sden_2354
Enzymes [BR:sdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sden_2354
Peptidoglycan biosynthesis and degradation proteins [BR:sdn01011]
 Precursor biosynthesis
  Amino acid ligase
   Sden_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: ABE55634
UniProt: Q12LP2
LinkDB All DBs
Position
2800113..2801120
Genome map
AA seq 335 aa AA seqDB search
MAKINVLLLCGGGGAEHDISLMSARFFETSLAKSDQFSVLTLTLDKQGRYHTQDGNLCSL
TNRREIRFEDPSIAPWAVDYVIPCIHGFPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGVPNTPYIFLHQFDQEAIAQTQAAFDTWGSVFIKAASQGSSVGCYKVDVR
DNIAKVLEEAFGYAPYVVVEKTIKARELEVAVYEYQGDIIATLPGEIICDTNKFYSFDEK
YAKDSKARTDVVASNLSPKLCLQIQDYAIKAFKGMKLRHLSRIDFFLTQDDEILLNEINT
FPGLTPISMFPKMLQNHGHDFTEYLSDVISQQLGR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctaagattaatgtgttgctactttgtggtggcggcggcgcagaacacgatatttca
ttgatgtcggcgcgtttttttgaaacttccttagccaaatctgaccaattttctgtgctt
acactcaccttagataaacagggtcgatatcacactcaagacggcaacttatgctccctc
accaatcgtcgcgagatccgcttcgaagaccccagtatcgcaccttgggcggtggattat
gttatcccctgtattcatggttttcccggtgaaactggcgacatacagtcttacttcaac
ttaattcaactgccctattttggctgtgagtctgaagcctcaagtaattgtttcaataag
atcaccgccaagatgtggttcagtgccttaggtgtacccaatactccgtacattttcttg
catcaatttgaccaagaagccattgcccaaacccaagccgccttcgacacttggggctca
gtgtttatcaaagccgcctctcaaggctcatctgtgggctgctacaaggtcgatgtacgt
gacaatatcgccaaggtactggaagaggccttcggctatgcgccttatgtggtggtagag
aagaccattaaagcccgtgagcttgaagtggcagtatatgaatatcagggcgacatcatc
gccaccttgcccggtgaaatcatctgtgacaccaataagttttatagtttcgatgaaaaa
tacgccaaagactccaaggcgcgcaccgatgtggtcgccagcaatttatcgccaaaatta
tgcctgcagatccaagactatgccatcaaggcatttaaaggcatgaagctgcgtcattta
tctcgcattgattttttcttaactcaagatgatgaaatattactaaatgaaatcaatacc
ttccctgggttaacgcctatatccatgttccctaagatgctgcaaaatcatggtcatgac
ttcactgaatacttgagcgatgtgataagccagcaactcggccgttaa

DBGET integrated database retrieval system