KEGG   Shewanella denitrificans: Sden_3011Help
Entry
Sden_3011         CDS       T00344                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sdn  Shewanella denitrificans
Brite
KEGG Orthology (KO) [BR:sdn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sden_3011
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sden_3011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO Thi4 AlaDh_PNT_C NAD_binding_8 Glutaredoxin FMO-like NAD_binding_7 K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABE56289
UniProt: Q12JT7
LinkDB All DBs
Position
complement(3615965..3617560)
Genome map
AA seq 531 aa AA seqDB search
MLDANVKNQLKTYLQNLKRPVELVVSADDSKKSQELTSLAQDIVDSSALVTLSKVQGART
PSMAVINPDNNSQITFAGLPMGHEFTSLVLALLHSGGHPLKLDTDVIEQIKQLPGKYQFE
TYVSLSCQTCPEVIQALNMMAAINPNITNVMIDGALFQDEVAQRNILSVPAVYLNGEPFS
VGAISVVEILNKLDTGAASRKAEALSQKSAFDVLVVGGGPAGAAAAIYAARKGLVTGIVA
DKFGGQVAETVGIENFISVSKTEGPKLVANLESHVHDYDVDIMANQKANTLVKEGLFKLG
LESGASLSSKTILLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANLVEHVTVLEFDVNLRADEVLQRKAKSMGNITIITQAMTTKVLGDGKRVTG
LSYTDRKSGESHEVTLAGIFVQIGLVPNTEWLRGVVELTERGEIIVDAKGQTSIPGVFAA
GDVTNVPFKQIIIAMGSGASASLGAFDYLIRHSDEAVIQQVKASETAASAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatgtaaaaaatcaactgaaaacctacctgcaaaacctcaagcgccca
gttgaacttgtcgtgtctgcagatgactcgaaaaaatctcaagagttaacaagcttagcc
caagacatagtcgacagctcagccttggtgaccttgagcaaagtacaaggcgcgcgcaca
ccaagtatggcggtgataaatcctgacaataatagccagattacctttgcaggtctgcct
atgggtcacgagtttacctcgttagtattggcactactgcacagcggtggccatccatta
aagctcgacaccgatgtgattgaacaaattaaacagttgccgggtaaataccaatttgag
acctatgtgtccttaagttgccagacttgccccgaagttatccaagcattgaatatgatg
gccgcgataaaccctaacattactaatgtcatgatagatggcgcattatttcaagatgaa
gtggcacagcgtaatattctctctgtacctgctgtgtatcttaatggcgagccgttctct
gtgggcgctatcagtgtggtagaaattttaaataaattagatacgggggcagcaagccgt
aaagcggaagctttaagccaaaagtcagctttcgatgtgctggttgtgggcggcggtcct
gcgggcgctgctgcggccatttacgcggcccgtaaaggtttagtcacaggtatcgttgcc
gataaatttggcggtcaagtggcagaaaccgtaggtattgaaaactttatttcggtatct
aaaacagaaggcccaaagcttgtggctaaccttgagtcacacgtgcatgactatgatgta
gatatcatggccaatcaaaaagccaatactttggttaaagaaggtctatttaagctaggc
cttgaaagcggcgccagcttaagcagtaaaaccattttactggcaactggcgcaaggtgg
cgtgaaatgaatgtccctggtgagcaagagtaccgcggaaaaggcgtggcctattgcccc
cattgtgacggccccttatttaaaggtaagcgagtggctgtgattggcggcggtaactca
ggtattgaagccgctatcgatttggccaacctagttgagcatgtgacagtgctcgaattt
gatgtgaaccttcgagctgatgaagtgttgcagcgtaaagctaagtctatggggaatatc
accattattacccaggcgatgacgacgaaagtactgggtgatggcaagcgagtgacaggc
cttagctacacagatagaaagagtggcgagagccatgaagtgacacttgcgggtattttc
gtgcaaatcggcctagtacccaatactgagtggttaagaggcgtggtggagctaaccgaa
cgaggtgagattattgtcgatgccaaaggtcagacttcaattcctggggtatttgccgcg
ggggatgtcaccaacgtgccctttaagcagattattattgctatgggcagtggcgctagc
gcatcccttggggcatttgattaccttattcgccactcggatgaagctgttatccaacag
gtcaaagcaagtgaaacagcagccagcgcggcatga

DBGET integrated database retrieval system