KEGG   Sulfitobacter donghicola: SD1155_05255Help
Entry
SD1155_05255      CDS       T05893                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sdo  Sulfitobacter donghicola
Pathway
sdo00790  Folate biosynthesis
sdo01100  Metabolic pathways
Module
sdo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SD1155_05255 (folP)
Enzymes [BR:sdo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SD1155_05255 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind E1-E2_ATPase
Motif
Other DBs
NCBI-ProteinID: QAV31018
UniProt: A0A410XWQ3
LinkDB All DBs
Position
1085962..1086765
Genome map
AA seq 267 aa AA seqDB search
MSKTKIMGILNVTPDSFSDGGKYNSVEKAVSRTKEMIDEGVDIVDVGGVSTRPGYQEVTL
EEELNRVIPVVEALIGLNVQISIDTYRSEVAEACLKLGATMINDQWAGLYDPKILNVVAQ
YDAEIVLMHNGDGKRDKPVVDEMLVTLLAQANKAEMAGIPHSKIWLDPGIGFAKTRDEEN
EVMARLDELVATDYPILLATSRKRFIKEMIGGESKALERDEATAATTAYGIMKGVQAVRV
HNVKLNSRIAQSMDFLKENENERHHIS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaactaaaattatgggcatacttaacgtaacgccagattcattttcagatggt
gggaaatataattctgttgaaaaagcagtttcgcgaacgaaagaaatgattgatgaaggt
gttgatatagttgatgtaggtggtgtttcaactcgacctgggtatcaagaagttactcta
gaagaagagttgaatagagttataccagttgttgaagcattgatagggcttaatgtacaa
atatcaattgatacatatagaagtgaagtagcagaagcttgtttgaagttaggcgctaca
atgattaatgatcaatgggctggtttgtatgatcctaaaatattgaatgttgttgctcaa
tatgatgcagaaattgttctaatgcataatggggatggtaaaagagataagccagttgta
gatgaaatgcttgttaccttattagcacaagccaataaagctgaaatggcaggtatccca
cattcaaaaatttggctagatcctgggatagggtttgctaaaactagagatgaagaaaat
gaagtgatggcacgacttgatgagttagttgcaacagattatccgattttattggctact
agtcgtaaaagattcattaaagaaatgataggtggagaatcaaaagcccttgaaagagac
gaagctacagcagcaacaactgcttatggtataatgaagggcgttcaagctgtgagagta
cacaatgttaaacttaattcacgtattgcacaaagcatggattttctaaaggagaatgaa
aatgaacgacatcatatttcttaa

DBGET integrated database retrieval system