KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0599Help
Entry
SDSE167_0599      CDS       T02870                                 

Gene name
amyS
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
sdq00500  Starch and sucrose metabolism
sdq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDSE167_0599 (amyS)
Enzymes [BR:sdq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SDSE167_0599 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: BAN92991
LinkDB All DBs
Position
528840..530303
Genome map
AA seq 487 aa AA seqDB search
MTNQLIMQAFEWYLPADGNHWKTVKASIPQLQHLGVTELWLPPAFKGTGINDVGYGVYDL
FDLGEFDQNGTVITKYGSKQEYLDLITALKEAAIKPIADIVLNHKANGDHKERFFVIKMN
PENRQEALTEPYEIEGWTGFDFPGRNGCYNDFKWHWYHFTGLDYDAKNNETGIYMITGDN
KGWANNDLIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFVNDIRTQIKPDLEVFGEYWKSDQDSMEDYLEATNEQFALVDVGLHMSFFNASH
QGKDFDLTHIFEGSLVASRPDLAITFVENHDTQRGQALESTVEDWFKPLAYGLILLRQEG
KPCLFYGDYYGISGDFAQASFKEVLDKMTLLRKEAVYGEQVDYFDHANCIAWTCLGDEEH
PHPLAVILSNGDEGWKHVEIGQDFVGQTFVDYLGYCSEKVVVAEDGWLDIKVEAGSISAW
VPEERSF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaactaatcatgcaggcttttgagtggtatcttcctgcagatggtaaccac
tggaaaacagtgaaagcaagtattccacaattacagcatttaggagtgactgagctctgg
cttcctcctgcttttaaaggaactggtattaatgatgtgggatatggtgtttatgattta
tttgacctaggggaatttgatcaaaatggcacagtcattaccaaatacggtagtaaacaa
gaatatctcgaccttattacagctttgaaagaagctgccatcaaaccaatcgcagatatt
gttcttaaccataaagccaatggagatcataaggaacgtttttttgtcatcaaaatgaat
cctgaaaatcgccaggaagctctgacagaaccttatgagattgaaggttggactggtttt
gactttcctggtcgaaatggttgctataatgattttaaatggcattggtatcatttcaca
gggcttgattatgatgccaagaacaatgaaactggcatttacatgattacaggtgacaat
aagggctgggccaacaatgacttgattgatgacgaacatggtaattttgattacctcatg
tacaatgatttggacttcaaacacccagaggttattcaaaacttgcaggattgggctaag
tggtttattgagacaacaggaatcgaaggttttcgtctagatgccgtcaaacacattgat
tcttattttatccaaacctttgtcaatgatattcgcactcaaatcaaaccagatttagaa
gtttttggtgagtattggaagtcagaccaagactccatggaagactacttggaagccacc
aatgaacagtttgctttagtagatgtcggtcttcacatgtctttctttaacgccagtcat
caaggaaaggattttgatttaacacatatctttgaaggaagtttagtggctagcaggcct
gacttggctattacttttgttgaaaatcatgacacgcaacgtggtcaagctttggagtcc
acagtggaagattggtttaaacctctggcctacggcttaattctcttgcgccaagaaggc
aaaccttgtctgttctatggcgattactatggtatttccggagactttgctcaagctagt
tttaaagaagtgcttgacaagatgacgctgttgcgtaaagaggctgtttacggggaacaa
gtcgattattttgatcacgctaattgcattgcctggacttgtttaggcgatgaagaacat
ccccatccgctggcagttatcctatcaaatggtgatgaaggttggaagcatgtggaaatc
ggtcaagactttgtcgggcagacctttgtcgattacttaggctattgttcagaaaaggta
gtggtggctgaagatggttggcttgatattaaggtggaggcaggctctatttcagcctgg
gtacctgaagaaagaagcttttaa

DBGET integrated database retrieval system