KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0682Help
Entry
SDSE167_0682      CDS       T02870                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sdq03012]
    SDSE167_0682
   03029 Mitochondrial biogenesis [BR:sdq03029]
    SDSE167_0682
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdq04147]
    SDSE167_0682
Translation factors [BR:sdq03012]
 Eukaryotic Type
  Elongation factors
   SDSE167_0682
 Prokaryotic Type
   SDSE167_0682
Mitochondrial biogenesis [BR:sdq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SDSE167_0682
Exosome [BR:sdq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SDSE167_0682
  Exosomal proteins of breast cancer cells
   SDSE167_0682
  Exosomal proteins of colorectal cancer cells
   SDSE167_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAN93074
LinkDB All DBs
Position
608993..610189
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPTSVNQPKDYASIDAAPEER
ERGITINTAHVEYETETRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIIMELMSTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccccacgttaacattggtacaattggacac
gttgaccatggtaaaacaactttaacagctgcaattacaacagtacttgcccgtcgttta
ccaacttcagttaaccaaccaaaagattatgcttctatcgatgctgctccagaagagcgc
gaacgcggaatcacaatcaacactgcacacgttgagtatgaaactgaaactcgtcactat
gctcacatcgacgcaccaggacacgcggactatgttaaaaacatgatcactggtgctgcc
caaatggacggagctatccttgtagttgcttcaactgatggaccaatgccacaaacgcgt
gagcacatccttctttcacgtcaagttggtgttaaacatcttatcgtcttcatgaacaaa
gttgaccttgttgatgacgaagagttgctcgaattagttgagatggaaattcgtgacctt
ctttcagaatacgatttcccaggtgatgaccttccagttatccaaggttcagctcttaaa
gctcttgaaggtgactcaaaatacgaagatatcatcatggagttgatgagtactgttgat
gagtacatcccagaaccagaacgcgacactgacaaaccattacttcttccagtcgaagat
gtattctcaatcacaggtcgtggtacagttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactaaaaaagctgttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggagacaacgtaggt
atccttcttcgtggtgttcaacgtgacgaaatcgaacgtggtcaagttattgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtatatatcctttctaaagacgaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataac
gtgacaatcaacgttgagttgattcacccaatcgccgtagaacaaggtactactttctca
atccgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system