KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_0998Help
Entry
SDSE167_0998      CDS       T02870                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
sdq00240  Pyrimidine metabolism
sdq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SDSE167_0998 (tdk)
Enzymes [BR:sdq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SDSE167_0998 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 DUF4371
Motif
Other DBs
NCBI-ProteinID: BAN93389
LinkDB All DBs
Position
911170..911772
Genome map
AA seq 200 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVVSSRIGMRREAV
PISSDMDVFTFIDQLEEKPYCVLIDESQFLSKQNVYDLARVVDKLNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPVSTEQSVMTEKN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagtagcacataattatgaagaacaaggcaaacctgttgtcattatgacaagtgctctt
gatacgcgtgatggttttggcgtcgtttcaagtcgtatcggcatgcgacgagaagcagtt
cctatttctagtgatatggatgtttttacctttattgaccaattggaggaaaaaccttat
tgtgtcttgattgacgaaagccaatttttaagcaagcaaaatgtttatgatttggcgcgt
gtggtggataagttaaatgttcctgtcatggcttttgggttgaaaaatgattttcaaaat
gaactgtttgagggatcaaaataccttttgcttctggccgataagattgacgaaatcaaa
acaatctgtcaatattgcagcaagaaagccacgatggttttacggactgaaaatggaaaa
ccggtgtatgagggtgctcagatacaaatcggagggaatgaaacctatattccagtttgc
cgtaagcattactttcacccacccgttagcaccgaacagtcagtaatgactgagaaaaac
taa

DBGET integrated database retrieval system