KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_1367Help
Entry
SDSE167_1367      CDS       T02870                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
sdq00010  Glycolysis / Gluconeogenesis
sdq00020  Citrate cycle (TCA cycle)
sdq00620  Pyruvate metabolism
sdq01100  Metabolic pathways
sdq01110  Biosynthesis of secondary metabolites
sdq01120  Microbial metabolism in diverse environments
sdq01130  Biosynthesis of antibiotics
sdq01200  Carbon metabolism
Module
sdq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDSE167_1367 (acoC)
   00020 Citrate cycle (TCA cycle)
    SDSE167_1367 (acoC)
   00620 Pyruvate metabolism
    SDSE167_1367 (acoC)
Enzymes [BR:sdq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SDSE167_1367 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-ProteinID: BAN93755
LinkDB All DBs
Position
complement(1198470..1199879)
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDVLLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPTVAPKEDVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVELPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINNANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctcggcgttgacatgcaagagggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatgtccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgttctattgaaaattgtt
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagaaggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagatgcaggaccaacagtagctccaaaagaagatgtggccagtccagctcctcaggta
gcagcgacagctattccgcaaggaaatggtggaaaagttcgtgctactccagctgcacgt
aaggttgcagcagaaatgggcattgaccttggtcaagttccaggaacaggaccaaaaggg
cgtgtccataaagaagatgttgagaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaatcgctgctgataaaggtatcgacttggcgactgtttcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagctgctaaaccagctgaa
gcaaaagcaccagcagctaaagaagaaaaagttgttgagcttccagagggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcgcctacctttacgcttaactacgatattgatatgacagaaatgatcgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaacgttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaataacgctaatgatattgaattgcaccgctttgtgaacctgggtattgccgtaggt
cttgatgatggtcttattgttccagttatccatggtgcagataagatgagcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctcaatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcgatgtgcttaaccatc
gaccatcgcttggtagacggtatgaacggtgcaaaattcatggttgacctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system