KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_1869Help
Entry
SDSE167_1869      CDS       T02870                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
sdq00061  Fatty acid biosynthesis
sdq00780  Biotin metabolism
sdq01100  Metabolic pathways
sdq01212  Fatty acid metabolism
Module
sdq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SDSE167_1869 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SDSE167_1869 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sdq01004]
    SDSE167_1869 (fabZ)
Enzymes [BR:sdq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SDSE167_1869 (fabZ)
Lipid biosynthesis proteins [BR:sdq01004]
 Fatty acid synthase
  Component type
   SDSE167_1869 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: BAN94244
LinkDB All DBs
Position
complement(1679752..1680174)
Genome map
AA seq 140 aa AA seqDB search
MMDIREIQAALPHRYPMLLVDRVLEVSEDRIVAIKNVTINEPFFNGHFPQYPVMPGVLIM
EALAQTAGVLELSKEENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFIKRRGTIAVVEA
KAEVDGKLAASGILTFAFGQ
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgatggatattagagaaattcaagcggctttgcctcatcgttacccgatgttattggtt
gatcgtgtattagaggtgtcagaggatcgcattgttgccattaaaaatgtgaccattaat
gaacctttctttaacgggcattttcctcagtatccggttatgccaggtgttctgattatg
gaagctctggctcaaacagccggtgtactggaattgtcaaaagaagaaaataaagggaag
ttggtcttttacgctggaatggataaagtgaagtttaaaaaacaagtcgttcctggggac
caacttgtcatgacagccacttttatcaagcgccgtggcacgattgctgttgtggaagct
aaggcagaagtggatggcaagctagcagcaagcgggatattgacctttgccttcgggcaa
tga

DBGET integrated database retrieval system