KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_1903Help
Entry
SDSE167_1903      CDS       T02870                                 

Gene name
alaT
Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Pathway
sdq00220  Arginine biosynthesis
sdq00250  Alanine, aspartate and glutamate metabolism
sdq00290  Valine, leucine and isoleucine biosynthesis
sdq01100  Metabolic pathways
sdq01110  Biosynthesis of secondary metabolites
sdq01130  Biosynthesis of antibiotics
sdq01210  2-Oxocarboxylic acid metabolism
sdq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SDSE167_1903 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    SDSE167_1903 (alaT)
   00220 Arginine biosynthesis
    SDSE167_1903 (alaT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdq01007]
    SDSE167_1903 (alaT)
Enzymes [BR:sdq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SDSE167_1903 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     SDSE167_1903 (alaT)
Amino acid related enzymes [BR:sdq01007]
 Aminotransferase (transaminase)
  Class I
   SDSE167_1903 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAN94278
LinkDB All DBs
Position
complement(1709678..1710892)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPEVDIEDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEADWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEVLEDIVALAREHQLIIFADEIYDRLVMDGEEHVAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIHEAINAIPGLSAVKPKAGLYLFPKIDRNMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPTVEELEDVQEKITRVLHQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgtcgcctacgacattcgaggtcct
gttttagacgaggccaaccgtatgattgctaacggtgaaaaaatccttcgattaaacacc
ggtaacccagcggcttttgggtttgaggctcctgatgaggtcatccgtgatttgattgtc
aatgcgaggcttagtgaagggtattcagatagcaagggtatcttttctgcccgcaaagcc
attatgcaatattgtcagctgaaaggtttcccggaggtagatattgaggatatttatttg
ggaaatggggtgtcagaattaatttccatgtcattacaagccctgcttgatgatggggat
gaggtgttggttcctatgccagattaccctctatggacagcctgtgtcagtctgggtggt
ggcaaagctgtgcattacttgtgtgatgaagaagcggattggtatcctgacattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaaccctaacaatccc
actggtgccctttaccctaaagaagtcctagaagatattgttgcccttgcaagagagcac
cagctgattatttttgccgatgaaatctatgaccgattggttatggacggagaggagcat
gttgccattgctagtttagcgccagatgtattttgtgtatccatgaatggcttatcaaaa
tcccatcgtattgctggtttccgagtaggttggatggtcttatctgggccaaaagatcac
gtgaaaggctatatcgaaggattgaatatgctagcgaatatgcgcctctgctccaatgtg
ttggcccaacaggtagtgcaaacatctctaggcggtcgtcagtctgttgatgagctcttg
ttgccaggtggacgtatttttgagcaacgtaattttatccatgaagccatcaatgcgatt
ccaggcttatctgcagttaaacccaaagcaggtctttacctttttcctaagattgatcgt
aatatgtatcgtatcgatgatgatgaagaatttgtgctccaattattaaaacaagaaaag
gtgatgttggttcatggccgaggcttcaactggaaggacccagaccacttccgaattgtg
tacttaccaaccgtggaagaattagaagatgttcaggaaaaaatcacccgcgtcttacat
cagtacaaacgctaa

DBGET integrated database retrieval system