KEGG   Streptococcus dysgalactiae subsp. equisimilis 167: SDSE167_2152Help
Entry
SDSE167_2152      CDS       T02870                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sdq  Streptococcus dysgalactiae subsp. equisimilis 167
Brite
KEGG Orthology (KO) [BR:sdq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SDSE167_2152 (ahpF)
Enzymes [BR:sdq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SDSE167_2152 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 FAD_oxidored GIDA Thi4 HI0933_like FAD_binding_3 DAO Glutaredoxin AlaDh_PNT_C Lycopene_cycl Thioredoxin_4 LPD7 NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAN94526
LinkDB All DBs
Position
1950568..1952100
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLESDLVLQAYLGDDEQSQKVKDFVEEIAAMSDRISVEETVLDR
KPSFKVAKKGQDSGVAFAGLPLGHEFTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPLSEEAFADKGVYDVLVVGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVSGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAADTANMTIIKNVATKDIVGDDHVTGLNY
TERDSGEDKHIDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccttgttagaatct
gacctggttttgcaagcttatcttggtgatgacgaacagtctcaaaaggttaaagacttc
gtggaagaaattgctgcgatgtctgatcgtatttcggttgaagaaactgtcttagaccgt
aaaccaagctttaaagttgcgaaaaaaggacaagatagtggggtcgcctttgctggtcta
cctttaggccacgaatttacgtctttcatccttgccctcttgcaagtatctggacgtgct
ccaaaagtagatcaagatgttattgaccgcatcaaggctattgatcgcccactgcatttt
gaaacctacgtcagcttaacctgccataactgtccagacgttgttcaagctctcaacatt
atgtctgttttgaatgacaagatttcacatactatggtggaaggtggcatgttccaagat
gaagtgaaagcaaaaggcattatgtctgtaccaactgtcttcttagatggtgaagaattc
acttcaggccgtgctactatcgaacaactcttagaacaagtcgctggtcccctttcagaa
gaagcctttgcggataaaggggtctatgatgtccttgttgttggtggtggacctgcgggc
aatagcgctgctatctatgcagcccgtaaaggattgaaaacaggtttattggctgagacc
tttggtggtcaggtcatggaaactgtcggcatcgaaaatatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtagaggcccataccaagtcttacgatgtggacatt
atcaaagcacaactagctacttctatcgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctattttagctctcggtgccaaatggcgtaac
atcaatgtttctggagaagatgaattccgtaataaaggggtgacttactgccctcactgt
gatggtcctctctttgaaggcaaggacgttgctgttatcggtggtggaaactctggatta
gaagctgcccttgatttggctggtcttgctaaacacgtttacgtgttagaattcttgcct
gagctcaaagctgacaaagtgcttcaagaccgcgcagctgatactgctaacatgactatt
atcaaaaatgttgctactaaagacattgttggtgacgatcatgttactggtctcaactac
actgaacgtgatagcggtgaagacaaacacattgaccttgaaggggtctttgtccaaatt
ggtcttgttccaaatacagcttggctcaaggatagcggtgtgaacctaaccgaccgcggt
gaaattatcgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttcaatgggatctggggctactgccgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system