KEGG   Sulfuricella denitrificans: SCD_n00435Help
Entry
SCD_n00435        CDS       T02857                                 

Definition
(GenBank) protein kinase:GAF
Organism
sdr  Sulfuricella denitrificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HDOD Pkinase_Tyr APH Pkinase_fungal DUF1207
Motif
Other DBs
NCBI-ProteinID: BAN34284
UniProt: S6AIE6
LinkDB All DBs
Position
complement(466238..468700)
Genome map
AA seq 820 aa AA seqDB search
MNQDLQKIDRFEVTRILGKGAQSVVYLAYDPKLQREVAIKTLHFTKQKDQQNEIQALIQE
SRTVSKMRHPNLVPIFEAGEYEGDPYLVFEYVEGKTLSDLLREKGALSANEAIGIIAPVL
DAVAHAHQNGIIHRDLKPSNILISPEGIPRVMDFGIAERISDKPGEHDDVLIGTPAYMAP
EYIDGRIISEKNDIFAAGLILYEMVVGHKAVQGSNIYQIMHRIASEPIELPPSGEISIDE
KLGDIILKALAKNPLDRYASAEEMGDALHSFMLAGEETAPPSAESKQSTLDFLLRRMRHR
GDFPALSESVSSINRVVSSDRESINKLSNSILKDFALTNKILRLVNTAFYSTYGGGTIST
ISRAVIILGFDAVRNIAVTLILFEHMQNKAHATHLKEEFIQTLFSGLIAKDIAKGASKDI
KDPEEAFICSMFHNLGRLLAMFYFQEEAESINRVMAQKECNEDIASAQVLGISYQDLGIG
IAKTWGFPEQIVHSMRKLPPDSIPRPKTAMDRLRIITSFSNELCAIVAHTPSEDRLKSIK
KLSGRYGDSMPIQEKQLQQTLEKALDEITQFAGTVRLGVRESRIGKQAANWTGHTHQVEV
AGASEHAAEGTELTEAEAQMQDTVAITATEGVTLAQGKLPEGMGNKPDAGNAQAILTAGI
QDISNSLVDGCSLNDLLRMILETMYRSMDFQRVLLCIKDAKQNAMVGRFGFGEDINQIVK
TFKFPLSYTPDVFHAALSKGVDILISDINEPKIKDRIPDWYRKTITAQTFVLFPLNIKNV
PVALIYADKEAAGGINMPENELSLLRTLRNQALLAIKQTL
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagacttacaaaaaatagaccgatttgaagtgacccggattctgggcaagggc
gcgcagagtgtggtttatcttgcgtacgaccccaaactgcaacgcgaagtggcgataaaa
accctgcatttcacgaaacagaaggatcagcagaacgagattcaggcgctgatccaggaa
tcgcgcacggtcagcaagatgcgccaccctaacctcgtacccatttttgaggccggggaa
tacgaaggcgacccttatctggtgttcgagtatgtcgaggggaagaccctgtccgatctg
ctgcgggaaaaaggggcgctatccgccaacgaggccatcggcattatcgccccggtgctc
gatgccgtcgcccacgcccaccagaacggcatcatccatcgagacctcaagccctccaac
atcctgatcagcccggaaggcatcccgcgggtgatggatttcggcatcgccgaacgcatc
tccgacaaaccgggcgagcacgacgatgtcctgataggcacgcctgcctatatggcgccg
gaatacatcgacggccggataattagcgaaaaaaatgatattttcgctgccggcctgatc
ctttacgaaatggtggttgggcacaaagccgtgcagggcagcaatatttaccagatcatg
caccgcatcgcttccgaaccgatcgaactccccccgagcggcgaaatatccatcgacgaa
aagctcggcgacatcatcctcaaggcactggcaaaaaatcctctcgaccgctatgccagc
gccgaggaaatgggagacgcgttacactcgttcatgctggcgggcgaagaaaccgcgcct
ccctccgccgaatcgaaacagagcacgctggatttcctgctgcggcggatgcgccaccgg
ggcgacttcccggccctgtcggagtcggtcagttccatcaaccgtgtagtttcttccgac
cgggaaagcatcaacaagctttccaactcgatcctgaaggatttcgccctcaccaacaag
attctgaggctggtcaataccgccttctatagcacatacggcggcggcaccatcagcacc
atttcgcgcgccgtgattattctcggcttcgacgcggtgcgcaacatcgccgtcaccctg
atcctgttcgaacacatgcagaacaaggctcatgcgacgcatctgaaggaagaattcatt
cagaccctgttcagcgggctcatcgccaaggatattgccaaaggcgcctccaaagacatc
aaggatcctgaagaagcctttatctgctcgatgttccataacctggggcgcctcctggcc
atgttctatttccaggaagaggccgaaagcataaacagggtcatggcccagaaagaatgc
aacgaagatattgcttccgcccaggtgctcggcatttcctaccaggacctgggcatcggc
atcgccaagacctggggcttcccggaacagatcgtgcacagcatgcgcaagctgccgccc
gactccataccccgtcccaaaaccgccatggacaggctgcgcatcatcaccagtttctcc
aatgagctatgcgctatcgttgcccatacgcccagcgaagaccggctgaagtccatcaaa
aaactctccgggcgctatggtgacagcatgccgatccaggaaaaacagttacagcagact
ctggaaaaagccctcgatgaaattactcagttcgccggcacggtgcgcctgggggtaaga
gagagccggattggcaagcaagccgccaactggaccgggcacacccatcaagtagaggtc
gcaggagcatcagaacacgctgctgaaggtaccgagctaaccgaggcagaggcgcagatg
caggacacggtggcgatcaccgcaaccgagggagtcactcttgcccagggaaagctgccg
gaaggcatgggaaacaagccggatgccggcaatgcccaggcaatcctcaccgccggcatc
caggacatcagcaattccctagtggatggctgctccctcaacgacctcctgcgcatgatc
ctggaaaccatgtaccgcagcatggactttcagcgcgtgctgttatgcatcaaggatgcc
aagcagaacgccatggtcgggcgcttcggcttcggcgaggatatcaaccagatcgtcaag
accttcaagttccccctcagctatactccggatgtgttccacgccgccttgtcgaaggga
gtggacatcctgatttccgacatcaacgaaccgaaaatcaaggatcgcattccggactgg
tatcgcaagactattaccgcccagaccttcgtgctgtttccgctgaatatcaaaaacgta
ccggtagcgctgatatatgcggacaaggaggctgcaggcggcatcaatatgccggaaaac
gagctgagcctgttaaggacactgcgcaatcaggccttgctggccatcaagcagacgcta
tag

DBGET integrated database retrieval system