KEGG   Sulfuricella denitrificans: SCD_n00610Help
Entry
SCD_n00610        CDS       T02857                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sdr  Sulfuricella denitrificans
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sdr03012]
    SCD_n00610 (tufA)
   03029 Mitochondrial biogenesis [BR:sdr03029]
    SCD_n00610 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdr04147]
    SCD_n00610 (tufA)
Translation factors [BR:sdr03012]
 Eukaryotic Type
  Elongation factors
   SCD_n00610 (tufA)
 Prokaryotic Type
   SCD_n00610 (tufA)
Mitochondrial biogenesis [BR:sdr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SCD_n00610 (tufA)
Exosome [BR:sdr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCD_n00610 (tufA)
  Exosomal proteins of breast cancer cells
   SCD_n00610 (tufA)
  Exosomal proteins of colorectal cancer cells
   SCD_n00610 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAN34453
UniProt: K6V8W5
LinkDB All DBs
Position
620332..621522
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEAKGYDQIDSAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAVLVVSAADGPMPQTREHI
LLARQVGVPYIIVYMNKADMVDDPELLELVEMEVRELLSKYDFPGDDTPIIIGSALKALE
GDQSDIGEPSIFKLAEALDTYIPQPERAIDGAFLMPVEDVFSISGRGTVVTGRIERGIVK
VGEEVEIIGIKPTIKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLAKPGS
ITPHTKFTAEIYVLSKDEGGRHTPFFQGYRPQFYFRTTDVTGAIELPAGTEMVMPGDNIS
ITVALIQPIAMEEGLRFAIREGGRTVGAGVVAKVIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggcaaatttgagcggacgaaaccgcacgtaaacgtaggtacgattggtcac
gttgaccacggcaagacaacgctgaccgcggcgatcaccacgatcctgtcgaagaagttt
ggcggcgaagccaaaggctatgaccagattgacagcgcgccggaagagaaggcacggggt
atcaccatcaacaccgcgcacgtcgaatacgaaaccgcgaatcgtcactacgcccacgtt
gactgcccgggtcacgccgactacgtcaagaacatgattaccggagccgcccagatggat
ggcgccgtcctcgtcgtgtccgccgcagacggtccgatgccccagactcgcgagcacatc
ctgctggctcgtcaggtcggcgtaccctacatcatcgtctacatgaacaaagccgacatg
gtggatgatcctgagttgctggaactggtcgaaatggaagtgcgcgaactgctctccaaa
tacgacttccccggcgacgacaccccgatcatcatcggttccgccctgaaagccctcgaa
ggcgaccagagcgacatcggcgagcccagcatcttcaagctggccgaagccctcgacacc
tacattccccagccagagcgcgccatcgacggcgccttcctgatgccggtggaagacgta
ttctccatctccggacgcggcaccgtcgtcaccggacgtatcgagcgcggcatcgttaag
gttggcgaagaggttgaaattatcggcatcaagcccaccatcaagaccacctgcaccggc
gtagaaatgttccgcaaactgctggatcaaggtcaggccggtgacaacgtcggcgtactg
ctgcgcggcaccaagcgtgaagacgtcgagcgtggccaagtgctggccaagcccggctcg
atcaccccgcacaccaagtttactgccgagatctacgtcctgagcaaagacgaggggggt
cgtcacaccccgttcttccagggctaccgtccccagttctacttccgcaccaccgacgtc
accggtgcgattgaactgccggccggcacggaaatggtgatgcctggcgacaacatctcg
atcacagtcgcactgatacagccgatcgcgatggaagaaggtctgcgtttcgcgattcgc
gaaggtggccgtaccgtgggtgctggtgtcgtagctaaggttatcgagtaa

DBGET integrated database retrieval system