KEGG   Sulfuricella denitrificans: SCD_n00865Help
Entry
SCD_n00865        CDS       T02857                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr03030  DNA replication
sdr03410  Base excision repair
sdr03420  Nucleotide excision repair
sdr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SCD_n00865
   03410 Base excision repair
    SCD_n00865
   03420 Nucleotide excision repair
    SCD_n00865
   03430 Mismatch repair
    SCD_n00865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sdr03032]
    SCD_n00865
   03400 DNA repair and recombination proteins [BR:sdr03400]
    SCD_n00865
Enzymes [BR:sdr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCD_n00865
    6.5.1.6  DNA ligase (ATP or NAD+)
     SCD_n00865
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SCD_n00865
DNA replication proteins [BR:sdr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SCD_n00865
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SCD_n00865
DNA repair and recombination proteins [BR:sdr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SCD_n00865
   NER (nucleotide excision repair)
    Other NER factors
     SCD_n00865
   MMR (mismatch exicision repair)
    Other MMR factors
     SCD_n00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: BAN34706
UniProt: S6AFN5
LinkDB All DBs
Position
868779..869555
Genome map
AA seq 258 aa AA seqDB search
MLANVYRSGTPLADYLVSEKLDGVRGYWDGEKLLTRGGERIEAPGWFTAGWPDFPLDGEL
WVGRGQFASAVSIVRQRTPDDAAWRTLSFMVFDLPGHPGSFAERNTALKPLLAGLALPWV
RPVEQFRVADRAGLRIAFDRVVKNRGEGLMLHRAASLYQAGRSDDLLKLKPYQDAEAKVI
AHLPGKGKHQGVLGALLVETAAGLRFRIGTGFSDAQRRNPPAPGSWVTYRHIGLNEESGI
PRFASFMRVREDIPGGER
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgaatgtctatcgcagcggcacgccgctggccgactatctggtcagcgagaaa
ctggacggggtacgcggttactgggacggcgaaaagctgctgacgcgcggcggggaacgc
atcgaggcgcccggatggttcactgcagggtggcctgatttccccctggacggcgagctg
tgggtcggacgagggcagtttgccagtgccgtatccatcgtgcggcagcggacgccggat
gacgctgcctggcgtacgctgagtttcatggtgttcgatctgccgggtcatccgggatcc
ttcgctgaacgaaacacggcgctgaaacccttgcttgccgggcttgcgctgccctgggtg
cgcccggtggagcagttcagggtggccgaccgggccggattgcgcatcgcgttcgaccgg
gtcgtcaagaacaggggtgaagggttgatgctccatcgcgccgcatccctttaccaggca
gggcgcagcgatgacctgctcaagctgaaaccgtatcaggatgctgaagccaaggtcatc
gcgcatctgccgggcaagggcaagcaccagggggtgctcggcgccttgctggtagaaacg
gcggcggggctgagattccgtatcggaacggggttttccgatgcgcaacgtcgaaacccg
cctgcgccgggaagctgggtgacgtatcgccatatcggactgaacgaagaaagcggtatt
ccccgctttgccagtttcatgcgggtgcgggaggatattcccggcggggagaggtag

DBGET integrated database retrieval system