KEGG   Sulfuricella denitrificans: SCD_n00998Help
Entry
SCD_n00998        CDS       T02857                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCD_n00998
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sdr02000]
    SCD_n00998
Enzymes [BR:sdr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SCD_n00998
Transporters [BR:sdr02000]
 Other Transporters
  Pores ion channels [TC:1]
   SCD_n00998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5 Tom37 GST_N_4 GST_C_6 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BAN34837
UniProt: S6B2E5
LinkDB All DBs
Position
1007424..1008092
Genome map
AA seq 222 aa AA seqDB search
MPKLHLVSHEICPYAQRAAIALIEKNAPYERTNIDFNNKPDWFGKISPLGKVPLLQVDDE
VIFESAVICEYLDETIAPRLHPEDPLKRAQHRAWIEFGSVLLGTIWEFNTTKDAEVFEEK
RKELQSRFEMIENVLQEGPYFAGKNFSLVDAAFGPIFRYFDVYDGIADFGVFANTPKVRA
WRQALAMRPSVRNAVAADYPQKLMNFIKSRDSELARRMAAVA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaattacatctggtaagccatgaaatctgcccgtatgcgcaacgtgcagccatc
gcgctaatcgaaaagaacgccccgtatgagcgcaccaatatcgacttcaacaataagccg
gactggttcggaaaaatttctccactcggcaaggtgcctctgcttcaggttgacgacgag
gttattttcgaatccgccgtcatctgcgaatacctggacgaaacgattgcgccgcgcctg
catcctgaagatccgctgaagcgcgcgcagcaccgagcatggatcgagttcggctcggtg
ctcctgggcacgatctgggagttcaatacgacaaaagacgcggaagtcttcgaggaaaag
cgcaaggaactgcaatcccgattcgaaatgattgaaaatgtattgcaggaaggcccttat
ttcgccggcaagaacttctcgctggtcgatgcggctttcggcccgatcttccgctatttc
gacgtgtatgacggtattgccgactttggtgtatttgccaacacgcccaaggtgcgtgca
tggcggcaagccctggcgatgcgcccttcagtcaggaatgcggtcgctgccgactacccg
cagaaactcatgaattttattaaaagccgtgactccgagctcgcgcggcgcatggctgct
gtagcatag

DBGET integrated database retrieval system