KEGG   Sulfuricella denitrificans: SCD_n01561
Entry
SCD_n01561        CDS       T02857                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00620  Pyruvate metabolism
sdr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCD_n01561
Enzymes [BR:sdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     SCD_n01561
SSDB
Other DBs
NCBI-ProteinID: BAN35382
UniProt: S6B423
LinkDB
Position
1570955..1574419
AA seq 1154 aa
MDLNQFLGLGDDSEDPQETRKRLQLYINLKLSSSGQPPCLEGESSDFLAVAQNLLQSYRE
KSRLLSGYLCPPDQRIQAFLDDYLADAADGSVPRLPENTLILDRHGVARELSLPVNKNEF
KGDYVSSYRIRNGVLHNPVSDRRTTKGLFHVTEGGLPIPGDKKAVPKVAFARLLREAINP
PEHLMRLPFAAGQPQEAAMFVSLLLRPVICPEIPGREPEKIMEIRFFAPGGLVSNLDFVE
SIFGNGGNPVLASNDVGLDVDHWSGHTGCVILAPHLTRLTKKELGLPHRDAASPRQQADG
MCWVDENELYNDGSAFKITARDERGVIVTILADNYFGYCKKEVKTQISYATNLFGLAEEE
HAGGALAFPRHNHGEEFGVDSITRVPGYSFEEIATQYGDLMIVQPEGYGIDKLHPEVIYV
PQDLRMDLHAQTINWMKDGVPQTIKLRPDHIYVQPNGYKVEMCKHPGAPSWRLVGTDPEG
TFCHKPCTVSGGGKSEISKSLNDAVIYGPLFVADLEKDLTQVEKIVKKNYSGRFKPGFEH
EDRDAARTLLSAERSLGSVIKVLTPSPSHTEEYNAWLEEIPDRILALVFIIKRMYRPEWG
DNWRNYLSTDFVNGHPGHELKLGERKLVGSYLRIGFAENGAWRVFKLRQDFIAADKVQME
DDISASVVVPAASLPNMSPKSDNPSVKLVRNCEYRLFQRPDEAIHRGFDLQAEQDMALRD
NFIANFEPINGESLSKIIDDVVGFDQYTDPMRKILREAHEANQYVVSSAHPRMVDGKPSK
NPRYLQLRLDLANPVRRYVAEIGARFNRRVPLGTPVIEPVNAVLVGRRNNPPEPGIRPLA
VYNPIHYQELPELFMDFICSLTGKSPSTTGAGSEGALTKGPFNALRPTVDMNNTLVSFIL
TGYAGYSTAAGYIGPNLRVDHDISLLVPEIWSRLKPQERDPRFLIENGYMEKIADFQYQG
RLIQASRLGYRITERFVHGFMGKMFDAPRAVFGEHILRPETQDMAVFVDGVENIVEAQQK
VAACYLEDGSVEDACPPLKALLHIMANGRYEGKDVHDPAIRALFTREALLASDWYQERLM
TKQARDIHLWERHIAYLDTFACRTSHQDLAERLDIHERLESAKTKLKLVKSTAYLQSLSG
TIGADPLRPMQSRT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atggatctgaatcaatttctggggctgggggacgattctgaagaccctcaagaaacccgc
aaacgccttcagctatacatcaacctgaagctgtcctcgtcgggccaaccgccctgcctg
gagggcgaaagtagcgatttcctggccgttgcgcaaaatcttctgcaaagctaccgggaa
aaatcccgcttgttgagcggctacctctgcccacccgatcaacgtatccaggcgttcctg
gatgattatcttgccgatgcagcagatggttccgtaccccggttgccggaaaacacgctg
atcctcgatcgccatggcgtggcccgagagctttccctgccggtgaacaagaatgagttc
aagggcgattatgtcagcagttatcgaattcgtaacggcgtactacacaacccggttagc
gaccgtcgcacgaccaagggattattccacgtaaccgagggcggactaccgatacccggc
gacaagaaagcggttcccaaggtcgcttttgcacgtctgttgcgtgaagcaatcaacccc
ccggaacatctgatgcgcctgccgttcgccgctggacagccgcaggaagcggcgatgttc
gtttcgctgcttcttcgcccggtaatctgccccgaaatccccgggcgcgaaccggaaaag
attatggaaattcgctttttcgcgccaggcggtctggtgagcaatctggattttgtagaa
agcatcttcggcaatggtggcaaccctgtactggcgtcgaacgatgtcggactggacgtg
gatcattggtccggtcacaccggttgtgtgattctggctcctcacctgacccgactcacc
aagaaagaacttgggcttccccaccgggatgctgcttcacctcgccaacaggcggatggt
atgtgctgggtcgatgaaaacgaactgtataacgatggttccgccttcaaaattaccgct
cgcgacgagcgcggggtgatcgtcaccatactggccgacaattacttcggatactgcaag
aaagaggtcaagacccagatcagctatgccaccaaccttttcgggctggctgaagaggag
catgcgggcggcgcactggcgttcccgcggcacaaccacggcgaggaattcggggtggac
agcatcacccgagtaccagggtacagctttgaagagatcgcgacccaatatggcgattta
atgattgtacaaccggaaggctacggcatcgacaagttgcatccggaagtcatttatgtg
ccgcaggacctgcgcatggaccttcacgctcaaaccatcaactggatgaaggatggcgta
cctcagaccatcaagcttcgtccggaccatatctacgtgcagcccaacggctacaaggtc
gagatgtgcaagcatccgggcgcgccatcatggcgtttggtgggcacggatccggaaggt
actttctgccacaagccctgcaccgtgtcaggtggaggaaaatcggagatttccaagtcg
ctgaatgacgcggtgatctacggcccgcttttcgttgccgatctggagaaggacctcact
caggttgaaaagatcgtcaagaaaaattactcgggccgcttcaaaccgggattcgaacat
gaggaccgggatgcagcccgcacgctactcagcgccgaacgcagcctgggttcggtgatc
aaggtactcaccccctccccctcccacaccgaggaatacaatgcctggctggaagaaatt
cctgaccgcattttagcgctggtgttcatcatcaaacgcatgtatcgcccggaatggggc
gacaactggcgcaactatctgtcgacggatttcgttaacggtcatcccggccatgaactc
aagctcggtgaaaggaagcttgtcggttcctatttacggataggttttgctgagaacggg
gcatggcgcgtgttcaagttacgccaggatttcatcgctgccgacaaagtacagatggag
gacgacatcagcgcctcagttgtcgttcccgctgcatccctgcccaatatgtcaccgaaa
agcgacaacccttccgtcaagctcgtgcgtaactgcgagtaccgcctgttccagcgcccg
gacgaggcgattcatcgcggattcgatctccaggccgaacaggatatggccctgcgcgac
aactttattgcaaatttcgaaccgattaatggcgagtcattgtcgaaaatcatcgatgac
gtggtggggttcgaccagtacaccgaccccatgcgcaagattcttcgcgaagcccatgaa
gcaaaccaatatgtggtgtcctccgcacatccacgcatggtggacggcaagccgagcaag
aacccccgttacctgcaactgcggctcgacctcgccaacccggtaaggcgctatgtggcg
gaaattggtgccagattcaatcgacgggttcctttgggcacacccgtcatcgaacctgtc
aacgcagtgctggtgggccgtcgcaacaatccgccggaacccggcatacgccctttggca
gtctataatccgattcactatcaggaactgcccgagctgttcatggacttcatctgcagc
ctcaccggcaaatcgccctccacgacaggggctggcagcgaaggcgcgctcaccaaaggg
ccgttcaacgccctccggcccactgtagatatgaacaatacgctggtgtcttttatcctt
acaggttacgccggctattccaccgctgccggttatatcggcccgaatctccgcgttgat
cacgacatcagcctgctcgtgccggaaatctggtcacgcctgaagccacaggaacgggat
ccgcgcttcctgatcgaaaacggttacatggaaaagattgccgatttccagtatcaaggc
cgcctgattcaggcaagccgccttggctaccgcatcacggaacgctttgtacacggtttc
atgggcaagatgttcgatgcaccccgcgcagtatttggcgagcatatcctgcgtccggaa
acccaggacatggcggtgttcgtggatggcgtggaaaatatcgtcgaagcgcagcagaag
gtggcagcctgctatctggaagatggtagtgtggaagatgcctgcccaccgctcaaagcc
ctgcttcacatcatggctaatggccgttatgagggcaaagatgtgcatgaccctgccatc
cgggccttgtttacccgtgaagccttgctcgcttcggattggtaccaggaacgactaatg
acgaagcaggcgcgggacatccatctttgggagcgccacattgcttatctggataccttc
gcctgccgtacaagtcatcaggacctggcagaacggcttgacatccatgaacggctagaa
agtgccaagaccaagctgaagttggtcaagagcacggcatacttgcaaagcctgagtggt
actatcggcgccgacccgttacggccgatgcagtcaagaacatag

DBGET integrated database retrieval system