KEGG   Sulfuricella denitrificans: SCD_n02032Help
Entry
SCD_n02032        CDS       T02857                                 

Gene name
cbbS
Definition
(GenBank) ribulose-bisphosphate carboxylase, small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00630  Glyoxylate and dicarboxylate metabolism
sdr01100  Metabolic pathways
sdr01120  Microbial metabolism in diverse environments
sdr01200  Carbon metabolism
Module
sdr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCD_n02032 (cbbS)
Enzymes [BR:sdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SCD_n02032 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAN35843
UniProt: S6ACT3
LinkDB All DBs
Position
2075556..2075912
Genome map
AA seq 118 aa AA seqDB search
MSEVMDYKSRMSDPASRKFETFSYLPAMTAAEIKTQVEYLVSKGWNPAIEHVEPEYLMDS
YWYMWKLPMFGETDVTKVLAEAEACHKANPNNHVRLIGYNNFNQSQGAAMVIFRGKTV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtaatggattacaaatcgcgtatgtccgacccggccagccgcaagttcgag
accttctcctacttgccggccatgactgcggctgaaatcaagacgcaggtggaatacctg
gtttccaaaggctggaacccggctatcgagcacgtcgagccggagtacctgatggattcc
tactggtatatgtggaagctgccgatgttcggcgaaaccgatgtgaccaaggtgctggct
gaagcggaagcctgtcacaaggccaaccccaacaaccacgtgcgtctgattggttacaac
aacttcaaccagtcgcagggcgcggcgatggtgattttccgcggcaagacggtttaa

DBGET integrated database retrieval system