KEGG   Sulfuricella denitrificans: SCD_n02039Help
Entry
SCD_n02039        CDS       T02857                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00620  Pyruvate metabolism
sdr00680  Methane metabolism
sdr01100  Metabolic pathways
sdr01120  Microbial metabolism in diverse environments
sdr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCD_n02039
  09102 Energy metabolism
   00680 Methane metabolism
    SCD_n02039
Enzymes [BR:sdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SCD_n02039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAN35850
UniProt: S6AAH1
LinkDB All DBs
Position
2081976..2084783
Genome map
AA seq 935 aa AA seqDB search
MFRTPSDTQLRARVKLLGNLLGNVLRPLEDGRVLEAVEALRKGYIRLHKEDSPTSRRRLE
KLIKSLDAETLTHVVRAFSIYFSLVNLAEESFQHQTRRAQVRLGGPLWNGSFDATLRGFR
AQGISAAELQTLLDQAAYIPVFTAHPTESKRRTVMEHLRRIFLTTEQLDDTRTGKDRRLE
LVSQLEGQIQILWKTDEVRSNKPQVRDEIKNGLFYFRESLFKAVPETYRYLEKAIDRVYG
PELTAGQRIRVPNILRFGSWIGGDRDGNPFVTPDTTVLALRLQKREVLRYYLSEVVNLSH
VLTHSKRLCTISAPMAASLAQDEQRFAAVFGDYPQHFGQEPYRRKLYLMRYRLQHNLNAV
DALIEGRSGTPFVDSYPSEQEFLADLTLMRDSLISHGDHTAAHGELQDLIRNTETFGFYL
VHLDIRQESTRHTEAVAELLAQQPGLPDYSSLSEVQRLELLGDLIGRTQNFSISREPLSE
TSRETFEVFEVMARMRHEISPQAFGSYVISMTHAASHVMEVMFLASLAGLAGHNNNGWFC
HIGISPLFETIVDLEHIQPVMTALLDNPAYAALLGCYGNLQEVMIGYSDSAKDGGILASA
WSLYEAQTQITALARARGIECRLFHGRGGTVGRGGGPTHEAILSQPEGTVRGQIKFTEQG
EVLSFKYSNAETAVYELSMGMTGLLKASTSLIREQKQNRADFLGVMDKLAEDGETTFRGL
TDRTPGFIDYFYEVTPLTEIGLLNIGSRPSHRKKGDRSKASVRAIAWVFGWAQSRHTLPA
WFGIGTALQVWRSNDPQRLATLQRMYREWPFFRALLGNTQMALFKADMGIAARYAELAEN
TETADAIYQTISDEYHRTVTEVLSIADATSLMQETPQLALSLARRNPYLDPLNHIQVLLL
QRCRDESLPQVERDRWLSSLLRSINAIAGGLRNTG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaacacccagcgatacccagttgcgcgcccgcgtaaaactgctcggcaatttg
ctcggcaatgtactgcgccccttggaggacggccgcgtgctggaggcagtggaagccttg
cgtaaaggttacattcgcctgcacaaggaagattcgccaaccagtcggcgccgactggag
aagctcatcaaatctctggatgcagaaacactcacccacgtagtacgcgccttcagcata
tacttcagcctcgtcaacctggccgaggaatctttccagcaccagactcgtcgcgcccag
gtgcgtctcggtggccccctgtggaatggctccttcgacgccacgttgcggggatttcgc
gctcagggcatcagcgccgcggaacttcagaccctgctcgaccaggccgcgtacattccg
gtgttcacagcccatcccacagagtccaagcgccgcaccgtcatggaacacctgcgccga
atctttctcactaccgagcaactggacgacacgcgcaccggcaaggaccggcgacttgaa
ctggtcagccagctcgagggacagatccagatcctgtggaaaaccgatgaagtgcgttcc
aacaaaccgcaggtccgtgacgagatcaagaacgggttgttctacttccgcgaaagcctg
ttcaaggccgtgcccgaaacctaccgctatctggaaaaggccatcgaccgcgtctatggg
ccggaactgacagcaggccagcgcatccgggtgccgaacatcctgcgcttcggctcctgg
atcggcggcgaccgcgatggaaatccctttgtcacccccgacaccaccgtactggccctg
cgtctgcagaagcgggaagtgttgcgctattaccttagcgaagtcgtcaatctcagccac
gtactgacccattcgaaacgcctgtgcacgatcagcgctccgatggccgccagcctggcg
caagacgaacagcgctttgccgcggtgttcggcgactatccccagcatttcggccaggaa
ccttaccgccgcaagctttatttgatgcggtatcggctgcaacacaacctgaatgccgta
gatgcgctgatcgagggtcgtagcggaaccccgtttgtcgacagctacccgtcggaacag
gagttcctggcggacctcaccctgatgcgtgattctctcattagccatggcgaccacacg
gctgcccacggcgaactacaggacctgatccgcaacacggaaaccttcggcttttacctg
gtacatctcgatatccgccaggaatcgacccgccacactgaagccgttgccgaattgctc
gcccagcagccaggcctgcccgattacagcagcctcagcgaagtccagcggctcgaattg
ctgggtgacctgatcggccgcacacagaacttttctatcagccgggaaccgctcagcgag
accagccgagaaactttcgaggtatttgaagtgatggcgcgcatgcgccatgaaatcagc
ccacaggcttttggctcctacgttatctcgatgacccatgccgccagccacgtcatggaa
gtcatgttcctcgccagccttgcggggctggctggccacaacaacaatggctggttctgc
catatcggcatctcgcccctgttcgaaaccatcgtcgacctggaacacatccagccggtg
atgacggcgctgcttgacaacccggcctatgcggcactcctcggatgctacggcaacctg
caagaagtcatgatcggctattccgattccgccaaggacggcggcattctcgcatcagcc
tggtcactttacgaggcgcagacccagatcaccgcactggcgcgagcgcgtggcatcgaa
tgccgcctgttccatggccgcggcggtacggtcgggcgcggtggcggccccacccacgag
gccatactgtcgcaaccggaaggcaccgtgcgcggccagatcaagttcaccgagcagggc
gaggtactgtcgttcaagtacagtaatgcagaaaccgcagtctacgagctgtcgatgggc
atgaccggcctgctcaaggccagtaccagcctgatccgcgaacagaagcaaaaccgcgcc
gacttcctcggcgtcatggacaagctggccgaagacggcgagactaccttccgtggcctg
accgaccgcaccccaggcttcatcgactatttttacgaagtcacgccgcttaccgaaatc
ggcctgctcaatatcggctcacgcccttcacatcgcaaaaagggcgaccgttccaaagcc
tcagtacgtgctatcgcctgggtgttcggctgggcacaatcgcgccacaccctgcccgcc
tggttcggcatcggcaccgctctgcaggtttggcgcagcaacgatccgcagcgtctggcc
actctgcagcgcatgtatcgggaatggccctttttccgtgctctgctcggcaacacccag
atggccctgttcaaggccgacatgggcatcgccgcccgctatgctgaactggccgaaaat
acggaaaccgctgacgcgatctaccagacgattagcgacgagtatcaccgaaccgtcacc
gaggtgctgagcatcgccgatgccaccagtctgatgcaggaaacgccgcagctggccttg
tcgctggcgcgccgcaatccatacctggacccgctgaatcatatccaggtgctgctgttg
caacgctgccgcgacgaaagtctgccacaggtggagcgcgatcgctggctcagctccctg
ctgcgctctatcaatgccattgccggggggctgcgcaataccggctga

DBGET integrated database retrieval system