KEGG   Sulfuricella denitrificans: SCD_n02482Help
Entry
SCD_n02482        CDS       T02857                                 

Definition
(GenBank) d-alanine/d-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sdr  Sulfuricella denitrificans
Pathway
sdr00473  D-Alanine metabolism
sdr00550  Peptidoglycan biosynthesis
sdr01100  Metabolic pathways
sdr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCD_n02482
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCD_n02482
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCD_n02482
Enzymes [BR:sdr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SCD_n02482
Peptidoglycan biosynthesis and degradation proteins [BR:sdr01011]
 Precursor biosynthesis
  Amino acid ligase
   SCD_n02482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 ATPgrasp_ST TTL ATPgrasp_Ter Neuropep_like CPSase_L_D2 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: BAN36289
UniProt: S6AN81
LinkDB All DBs
Position
complement(2538219..2539193)
Genome map
AA seq 324 aa AA seqDB search
MTEKDDQGETRGFSPHPSPLTPHLFGKVAVLLGGKSAEREVSLKSGNAVLAALKRSGVDA
HAFDPSERELGELKRDGYQRVFITLHGGQGEDGTVQGALALLGIPYTGSGVLASALAMDK
WRSKLVWQAAGMPVPAYELLDAASDFAAVAVRLGLPLFVKPANEGSSVGISKVKSVADLR
AAFELAARYDDLVIAEQFVGGGEYTVAILGSEVLPVIKIEPANEFYDYEAKYLRDDTRYL
CPCGLSAEQESEIQRLAKQGYAIIGGAGWGRVDFLLDAAGKPYLLEANTSPGMTDHSLVP
MAARAAGLSFEDLVIKVLELASAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgacggagaaagatgaccaaggggaaacccgggggttttcccctcacccctcacccctc
acccctcacctcttcggaaaagtcgcggtgctgctgggcggaaaatccgccgagcgtgag
gtgtcacttaaaagcggtaatgcagtgctggccgcgctcaagcgcagcggcgtcgatgcg
catgcgttcgatccgtccgagcgggagttgggcgagctgaagcgtgatggttaccagcgt
gtgtttatcaccctgcacggaggtcaaggcgaggatggtacggtgcagggcgcgctggcg
ctgctgggcattccctataccggcagcggtgtgctggcgtctgctctggcgatggacaaa
tggcgcagcaagctggtgtggcaggcggcgggaatgccggtacccgcctacgagttgctc
gatgccgccagcgatttcgcggcggtcgctgtgcgcctcggattgcctctgttcgtcaag
ccggctaacgagggctccagcgtcggcatcagcaaagtgaagtcagtcgcggatttgcgc
gccgcgttcgaactggcggcgcgctacgacgatctggtgattgccgaacaatttgtcggt
ggcggagagtacaccgtcgcgatcctcggcagcgaggttctgccggtgatcaaaatcgag
ccggccaacgagttctacgattacgaagcgaaatacctgcgcgacgacacccgctacctt
tgcccgtgcggtttatccgcagaacaggaaagtgaaattcagcgcctggcaaaacaaggc
tacgccataatcggcggcgccgggtgggggcgggtggatttcctgctcgatgcggcaggc
aagccgtacttgctggaagccaatacctcgcccggaatgaccgaccatagcttggtgccg
atggcggcgcgggcagcgggcctgagttttgaagatttggtgatcaaggttcttgaactg
gcgagtgcgggatga

DBGET integrated database retrieval system