KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_2029Help
Entry
SDEG_2029         CDS       T00932                                 

Gene name
nga
Definition
(GenBank) NADase
  KO
K18153  NAD+ glycohydrolase [EC:3.2.2.5]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
sds00760  Nicotinate and nicotinamide metabolism
sds01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sds00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SDEG_2029 (nga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sds00537]
    SDEG_2029 (nga)
Enzymes [BR:sds01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     SDEG_2029 (nga)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sds00537]
 Enzymes
  SDEG_2029 (nga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADase_NGA
Motif
Other DBs
NCBI-ProteinID: BAH82510
UniProt: C5WJE5
LinkDB All DBs
Position
1:complement(1964215..1965567)
Genome map
AA seq 450 aa AA seqDB search
MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANNTTYAVSDKEGKKSDVKYEMTKVME
ANATSSKEDKHVMHTLDGSMSTVWEENSPGGGIGEVLSYKFASPMHIGRILIVNGDTSSK
ENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEIDKKLDVDRIDIEVTEVH
QGQNKDILALSEVTFGNMERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAV
ASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDLMLAFDDAKRKSTIGRQE
NGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLG
YIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYF
EIIDPTIIAPNGDHKKVTGRFKIKKMQDRK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggtttacatgagaaacaaaaaagtaacattagctcatattgtcgcgaagacaagtgtt
gctattgctttggctggagcaatgggtagcagtttattagctaataacacaacgtacgct
gttagtgacaaagaaggtaaaaaaagcgatgtcaaatatgaaatgaccaaagttatggaa
gctaacgccacttcctctaaagaagacaaacatgtcatgcacacattagacggctcaatg
agtactgtttgggaggaaaattcacctggcggtggtattggtgaggtactttcttacaag
tttgcgtccccgatgcatattgggagaattttaattgttaatggagatacatctagcaag
gagaattactacaagaaaaatagaattgcaaaggctgatgttaaatactataacgggaat
aaattggtcctctttcaaaaaattgaattaggcgacacctacactaaaaaaccgcatcac
attgagattgataaaaaattagatgttgaccgtattgatattgaggtaacagaggtccat
cagggtcaaaacaaggatattttagccttgtcagaggtcacttttggcaatatggaacgc
gatatttttgaaaaaaagtttaaagaaattaaagataaatgggtaacagataaacaagca
gatgagtttattgaaactgccgacaagtatgctgataaagctgttcagatgtctgctgtt
gcgtcacgtgctgagtattaccgtatgtacgttagccgcaaataccactacaaaaaagag
tttgttgaaaaactaaaacaagtctacaaagaaagcggagcttcccacgttacaagcaaa
aaagatttgatgttagcttttgatgatgctaaaagaaagtcgacgattggtcgacaagaa
aacggtctttttgtgacaagttttgctgaagatatggcattgctctttactgatcaaggt
aagttaaaatcagctgaccaaattgaaaatataaaaggtgtcgatagcggaaaatatagc
gatggggtttatcaatatgagtacgattctgaactaacaaaaaacattgataagctaggc
tatatccgaacagctagcggagatactcctggagcaaattcgctcaacattcctggttgc
caaacgtggtcaggaaaacacattgaaaattcagaaagtgaattaattttcccatcgatt
agtgttaaagatctaaaatctaaagctgtcttagcagagattgatgccaaaggctatttt
gagattattgatcctaccatcattgctccaaatggtgaccataaaaaagtaactggtcgc
ttcaaaattaagaaaatgcaagataggaagtaa

DBGET integrated database retrieval system