KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_2054Help
Entry
SDEG_2054         CDS       T00932                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Brite
KEGG Orthology (KO) [BR:sds00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SDEG_2054 (ahpF)
Enzymes [BR:sds01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SDEG_2054 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored Thioredoxin_3 GIDA Thi4 HI0933_like Glutaredoxin FAD_binding_3 DAO Lycopene_cycl AlaDh_PNT_C Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAH82534
UniProt: C5WJG9
LinkDB All DBs
Position
1:1986309..1987841
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLESDLVLQTYLGDDEQSQKVKDFVEEIAVMSDRISVEETVLDR
KPSFKVAKKGQDSGVAFAGLPLGHEFTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQVAGPLSEEAFADKGVYDVLVVGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAADTANMTIIKNVATKDIVGDDHVTGLNY
TERDSGEDKHIDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccttgttagaatct
gacctggttttgcaaacttatcttggtgatgacgaacagtctcaaaaggttaaagacttc
gtggaagaaattgctgtgatgtctgatcgtatttcggttgaagaaactgtcttagaccgt
aaaccaagctttaaagttgcgaaaaaaggacaagatagtggggttgcctttgctggtcta
cctttaggccacgaatttacgtctttcatccttgccctcttgcaagtatctggacgtgct
ccaaaagtagatcaagatgttattgaccgcatcaaggctattgatcgcccactgcatttt
gaaacctacgtcagcttaacctgccataactgtccagacgttgttcaagctctcaacatt
atgtctgttttgaatgacaagatttcacatactatggtggaaggtggcatgttccaagat
gaagtgaaagcaaaaggcattatgtctgtaccaactgtcttcttagatggtgaagaattc
acttcaggccgtgctactatcgaacaactcttagaacaagtcgctggtcccctttcagaa
gaagcctttgcggataaaggggtctatgatgtccttgttgttggtggtggacctgcgggc
aatagcgctgctatctatgcagcccgtaaaggattgaaaacaggtttattggctgagacc
tttggtggtcaggtcatggaaactgtcggcatcgaaaatatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtagaggcccataccaagtcttacgatgtggatatt
atcaaagcacaactagctacttctatcgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttttacaagccaaaactgctattttagctcttggtgccaaatggcgtaac
atcaatgttcctggagaagatgaattccgtaataaaggggtgacttactgccctcactgt
gatggtcctctctttgaaggcaaggacgttgctgttatcggtggtggaaactctggatta
gaagctgcccttgatttggctggtcttgctaaacacgtttacgtgttagaattcttgcct
gagctcaaagctgacaaagtgcttcaagaccgcgcagctgatactgctaacatgactatt
atcaaaaatgttgctactaaagacattgttggtgacgatcatgttactggtctcaactac
actgaacgtgatagcggtgaagacaaacacattgaccttgaaggggtctttgtccaaatt
ggtcttgttccaaatacagcttggctcaaggatagcggtgtgaacctaaccgaccgcggt
gaaattatcgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttcaatgggatctggggctactgccgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system