KEGG   Staphylococcus pseudintermedius ED99: SPSE_0278Help
Entry
SPSE_0278         CDS       T02008                                 

Definition
(GenBank) oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SPSE_0278
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sdt02000]
    SPSE_0278
Transporters [BR:sdt02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SPSE_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N RsgA_GTPase AAA_21 AAA_22 AAA_23 AAA_16 RNA_helicase AAA_29 AAA_7 Guanylate_kin Mg_chelatase DUF2813 AAA_30 MMR_HSR1 DUF815
Motif
Other DBs
NCBI-ProteinID: ADX75622
LinkDB All DBs
Position
329337..330113
Genome map
AA seq 258 aa AA seqDB search
MNKLLNLNNLTVRQGERHVIESLDMTLYASKVNVLIGESGAGKSILIKALLGALPEHFEM
TYDEWHYQGQRVTSLKPYLGKQVGYISQDYTHSFNDHTPIGKQLIGIYRQHYKVSRQEAA
HQVQKALQWVGLDHLDLRKRYRFMLSGGQLERVLIASVMMLEPTLIIADEPTAALDAVTG
QQIMTLLHHLAEAHDVTLWVVTHNLTHVKRFSDYLYVLQHGRIVDHGDDIYFKSANIHPY
SALLFEHRSQLKQGESYD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttattaaacctaaacaacttaacagtacgccaaggtgaacgtcatgtcata
gaaagtctcgatatgaccctttatgcttcaaaagtgaacgtcttgattggtgaaagtggt
gcggggaaaagtatattgattaaggcgctactcggtgctttaccggaacattttgaaatg
acgtacgatgaatggcattatcaaggacaaagggtcacgtcattgaagccgtatttaggt
aaacaagtcgggtatatttcacaagattatacacatagttttaatgaccatacgccgatt
gggaagcagctcattgggatttatcgtcagcattacaaggtgtcgcgtcaagaagcggcg
caccaagttcaaaaagcgttgcaatgggtgggattagaccacctcgatttgcgcaaacgg
tatcgcttcatgctgtcaggagggcaactggaacgcgtcctgattgcgagcgtcatgatg
ttagaaccgacactcattatcgcagacgaacctactgccgcattagatgctgtgacaggg
cagcaaatcatgacgttactgcatcatcttgctgaagcacacgacgtgacgttatgggtc
gtgacacataacttaacccatgtgaaacgattcagtgattatctgtatgtgttgcaacat
gggcgtattgtggaccatggtgacgatatctatttcaaatcagcaaacatccatccgtac
agtgcgttgttatttgaacatcgaagtcagttaaaacaaggtgaatcatatgattaa

DBGET integrated database retrieval system