KEGG   Staphylococcus pseudintermedius ED99: SPSE_0383Help
Entry
SPSE_0383         CDS       T02008                                 

Gene name
aldA1
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00010  Glycolysis / Gluconeogenesis
sdt00053  Ascorbate and aldarate metabolism
sdt00071  Fatty acid degradation
sdt00280  Valine, leucine and isoleucine degradation
sdt00310  Lysine degradation
sdt00330  Arginine and proline metabolism
sdt00340  Histidine metabolism
sdt00380  Tryptophan metabolism
sdt00410  beta-Alanine metabolism
sdt00561  Glycerolipid metabolism
sdt00620  Pyruvate metabolism
sdt00625  Chloroalkane and chloroalkene degradation
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSE_0383 (aldA1)
   00053 Ascorbate and aldarate metabolism
    SPSE_0383 (aldA1)
   00620 Pyruvate metabolism
    SPSE_0383 (aldA1)
  Lipid metabolism
   00071 Fatty acid degradation
    SPSE_0383 (aldA1)
   00561 Glycerolipid metabolism
    SPSE_0383 (aldA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPSE_0383 (aldA1)
   00310 Lysine degradation
    SPSE_0383 (aldA1)
   00330 Arginine and proline metabolism
    SPSE_0383 (aldA1)
   00340 Histidine metabolism
    SPSE_0383 (aldA1)
   00380 Tryptophan metabolism
    SPSE_0383 (aldA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPSE_0383 (aldA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPSE_0383 (aldA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPSE_0383 (aldA1)
Enzymes [BR:sdt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SPSE_0383 (aldA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Latrotoxin_C
Motif
Other DBs
NCBI-ProteinID: ADX75725
LinkDB All DBs
Position
452063..453553
Genome map
AA seq 496 aa AA seqDB search
MSVNVRDYIDAQYNLFINGEFVPAESGEYLDVYNPANGEKLSQVAKASEKDVDKAVEAAT
KAFPDWSRRSKAERANMLRQVHDKIMEKKEHFAYVETLNAGKAIRESSSIDIPYTAKHYQ
YFGSVLDTDEGTLNNMEDHIMSIIQHEPIGVVGAVVAWNFPMLLSSWKLAPALAAGNTVV
IQPSSSTPLSLIELAKIFQEVLPAGVVNIVTGKGSESGNAIFNHKGVDKLSFTGSTAVGY
QVAEAGAKRLVPATLELGGKSANIILDDANLDLALEGSQLGILFNQGEVCSAGSRLIVHE
NVYDEFIPRLVDAFKKVKVGDPLDMETQMGSQTGQAQIDKIQSYIDYANESDGAKILVGG
HRITDNGLDKGYFFEPTIIEVDDADDKLAQEEIFGPVLVVIKVKDDEEAIDVANNSDYGL
AGGVFSTNINRALNVAKNVRTGRVWVNTYNQVPEGAPFGGYKKSGIGRETYKAAIENYQQ
VKNIYIDISNETKGLY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaatgtgagagattatattgatgcgcagtataacttatttattaacggtgaa
tttgttccagcagaatcaggggaatatttagatgtatataatccggcaaacggtgaaaaa
ttgtcacaagtcgctaaagcaagtgaaaaagatgtagataaagcagtagaagcagcaacg
aaagctttcccggattggagtcgtcgttcgaaagcagaacgtgcgaatatgttacgtcaa
gtccatgacaaaattatggagaaaaaagagcattttgcatatgtagaaactttaaacgcg
gggaaagcgatccgtgaatcaagcagtatcgatataccttatacagcgaaacattatcaa
tatttcggtagtgtgttagatactgatgaaggtacgctcaacaatatggaagatcacatt
atgagtatcattcaacatgaaccaatcggcgttgtgggtgcagtggtcgcttggaacttc
ccgatgttactgtcttcatggaaattagcacctgcccttgctgcagggaatacagttgtc
attcaaccttcgtcatcaacgccattaagtttgattgaattggcaaaaattttccaagaa
gtgttaccagcaggtgtggtaaacattgtgacaggtaaaggttctgagtcagggaatgcc
atctttaaccataaaggtgtcgataaattatcatttacgggttcaactgctgtcggttat
caagtagctgaagcaggtgcaaaacgtcttgtgcctgcaacgttagaacttggtggtaaa
agtgccaatattattttagatgatgcgaatctagatttagctttagaaggttcccaatta
ggtattttattcaatcaaggtgaagtatgtagtgcaggctctcgattaatcgtccatgaa
aatgtgtatgatgaattcattccacgcttggttgacgcgtttaaaaaagtgaaagtgggc
gatccgttagatatggaaacgcaaatgggttctcaaacaggtcaagcacaaatcgataaa
attcaaagttatattgactatgcaaacgaatctgacggcgcaaaaattcttgtaggtggt
caccgtattacagataacggtttagacaaaggttacttctttgagccaacaattatcgaa
gtggacgatgcggacgataaattagcgcaagaagaaatttttggccctgtgttagtagtg
attaaagttaaagatgacgaagaagccattgatgttgctaataattctgattacggctta
gcgggcggtgtcttctcaactaatatcaatcgtgcattaaatgttgcgaaaaatgtgcgc
acaggtcgcgtatgggtaaatacgtacaaccaagttcctgaaggtgcaccatttggcggt
tacaaaaaatcaggtatcggtcgtgaaacgtataaagcagctatcgaaaactatcaacaa
gttaaaaacatttatattgatattagcaatgaaacaaaaggtttatattaa

DBGET integrated database retrieval system