KEGG   Staphylococcus pseudintermedius ED99: SPSE_1034Help
Entry
SPSE_1034         CDS       T02008                                 

Definition
(GenBank) multidrug resistance transporter protein, putative
Organism
sdt  Staphylococcus pseudintermedius ED99
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_4 OATP MFS_2
Motif
Other DBs
NCBI-ProteinID: ADX76307
LinkDB All DBs
Position
1055353..1056534
Genome map
AA seq 393 aa AA seqDB search
MNMPKEIWWLVIGMAINITGASFLWPLNTIYMNEELDKSLSTAGLVLMVNSFGMIVGNLL
GGTLFDKLGGYRTIMLGTIVSLCATILLNFFHGWPWYAIWLIMLGFGGGMIIPAIYAMAG
AVWPQGGRQTFNAIYLAQNIGVALGAALGGFVAELSFNYIFMANLAMYVIFFFIALFQFN
MDYQATVKHQETLENVAHIQNKKHFTALILLCVMFALCWIAYVQWQTTIASFTQSIGISM
SQYSLLWTVNGVLILVGQPLILPIIHLIKGQLKKQLYIGLVVFILSFFVTSFATSFSIFV
VGMVIMTFAEMFVWPAVPTIANNLAPKGREGVYQGIVNSASTVGKAFGPLVGGILVDVFN
MQIMFLSMIGLLVIAMAFLTIYDRKVDPKTLYR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatgcctaaagaaatatggtggctcgtcattgggatggcgattaatatcacaggt
gcgagttttttatggccgttgaatacgatctatatgaatgaggaactcgacaaatcatta
agtactgctgggctcgtactgatggtcaattcatttggaatgattgtaggaaatttactt
ggtgggacattgttcgataaacttggaggatatcggacaattatgttaggcacgattgtg
agtttgtgcgctaccattttattaaatttcttccacggttggccttggtatgcgatttgg
ctcattatgctcggttttggcggtgggatgattatccctgctatttatgcgatggctgga
gcagtgtggcctcaagggggaagacaaacgtttaatgcgatttacttagcgcaaaatatc
ggtgtggcattaggtgcagcgctaggtggttttgttgctgaactaagctttaattatatt
tttatggcgaatttggcgatgtatgtcattttcttctttatcgcattatttcaatttaat
atggactatcaagcgacggttaaacatcaagaaacgttggaaaatgtggcgcacattcaa
aacaagaaacatttcacagcactcattttattatgtgtgatgtttgcgctatgttggatt
gcatacgttcaatggcaaacaactattgcgtcatttacacaaagtattggtatttctatg
agtcaatatagtttgttatggacagtgaacggggtgctcattttagtaggacaaccttta
atattaccgattattcacctcattaaagggcagctgaaaaagcaactttacattggatta
gtcgtatttatattgtcgtttttcgtgacaagttttgcgacatcattttcaatttttgtt
gtagggatggtcattatgacatttgcagaaatgttcgtttggcctgctgtaccaacgatt
gctaataatttagcgcctaaaggtagagaaggggtctatcaaggcattgtgaattctgct
tcaacagtggggaaagctttcggtccattagttggcgggatactcgtcgatgtgttcaat
atgcaaatcatgtttttatcaatgataggtttactcgtcatcgctatggcattccttacg
atttatgatagaaaagttgatccgaaaacgttatatcgttaa

DBGET integrated database retrieval system