KEGG   Staphylococcus pseudintermedius ED99: SPSE_1583Help
Entry
SPSE_1583         CDS       T02008                                 

Definition
(GenBank) serine/threonine-protein kinase PrkC, putative
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdt01001]
    SPSE_1583
Enzymes [BR:sdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPSE_1583
Protein kinases [BR:sdt01001]
 Serine/threonine kinases: Other
  Bacterial family
   SPSE_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal RIO1 Seadorna_VP7 Kinase-like Kdo FTA2
Motif
Other DBs
NCBI-ProteinID: ADX76841
LinkDB All DBs
Position
complement(1618216..1620222)
Genome map
AA seq 668 aa AA seqDB search
MIGRLIDDRYELKQILGGGGMSNVYVAMDTILNRQVAVKLIHIPPNEKQATIQRFEREVQ
NTTILTHPNIVSVLDVGEEVDFFFLVMEYIEGPTLADYIKANGPLKPEKALYFIEQILSG
IRHAHERGIVHRDIKPQNVMIDRNQTLKIVDFGIAKALSETTMTQTNHVVGTVQYLSPEQ
AKGEKTGERSDIYSIGIVLYEMLTGHPPFSGETAVSIAIKQIQEAVPNVTDTRRDVPQAL
SNVILKATEKDQSHRYRSVSEMAHDVMSTLDPTRQNEAIYEVDGTATKTVPINKNALKAE
QAKQGQAVDETAQIPIVTPEKQPQGQPKPKPQPAYYSPPPKRSGRKKWIFGVILLLLLGS
LFIFMGAAMTGDKYSQVPEVLGKSRAQAEKLLKDNKLTVGDVTYDYSDRYSKDQVMTVDP
EEGSKVEQESSVDLVISKGQRVEAMPNLVGMTKQDAERRLKELGFTHVTFTTAYTKNNIE
KGHIESQSIQPGQNVAVTQDKVEVTESLGKRQVYVGDYTNKDIDDVKAELEEKGLVVKIE
KERSDRRVKKHHIINHSPKKTNVEEGDTVSFIVSTGEKEDDEDSDSAVKAYSETVNIPYT
GESDKPQKVEVFITDKNDNGQSPAETFNITRDTPQTMQFVIEKNKSAKYVIKVDGKTVAR
KTIDFDDF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgattgggcgtttaatagatgaccgctacgagttgaagcaaattcttggtggcggtggc
atgtcgaatgtttatgtcgcaatggatactattttgaatcgtcaagtcgctgtgaaactc
attcatattccaccgaacgaaaagcaagcgacgatccaacgctttgaaagagaagttcaa
aacacgacgatactgacacatccaaatattgtcagtgttttagacgtgggtgaagaagtc
gactttttctttctcgtgatggaatatattgaagggcccaccttagccgattacattaaa
gcgaacgggccgttaaagcctgaaaaagcgctctattttatcgagcaaattttaagtggg
attcgtcatgcacatgaacgtggcattgtgcatcgtgatattaagccgcaaaacgtcatg
attgacaggaatcaaacgttaaaaattgtagactttggtattgcgaaagcactcagtgaa
acaacgatgacgcaaacgaatcatgttgttggcactgtccaatacttatcgcctgaacaa
gcaaaaggtgaaaaaacaggcgaacgttctgacatttactcaatcggtattgtattgtat
gaaatgttgacggggcatccaccttttagtggcgaaacggcagtgagtattgcaattaaa
caaatacaagaagctgtgccgaacgtgacagatacgcgaagagatgtgcctcaagcgtta
agtaatgttattttaaaagccacagaaaaggatcaaagtcaccgttaccgttcagtatca
gaaatggcgcacgatgtcatgtcgactttagatccgacccgtcaaaatgaagcaatatac
gaagtggacggtacagcaacaaaaactgtacccatcaataaaaatgcgttaaaagctgag
caagcgaaacaaggtcaagctgttgatgaaacggcacaaattccaattgtcacgcctgag
aagcaacctcagggacaacctaagccgaaaccacaacctgcttattatagtccgccaccg
aagcgctcgggacgcaaaaaatggattttcggtgtgattttattacttttattaggtagc
ttgtttatttttatgggtgcagcgatgactggagataaatatagtcaagtgcctgaagtg
ctcggcaaatcgagagctcaagccgaaaaactattaaaagataataaattgactgtaggt
gacgtcacatatgattacagtgaccgttacagtaaagatcaagtgatgaccgtcgatcca
gaagaaggcagtaaggtggaacaagaaagcagtgtggaccttgtcatctcaaaaggtcaa
cgtgtggaagccatgccgaacttggtaggtatgacgaaacaagatgccgaacgaagatta
aaagaattaggcttcacgcatgtgacatttacaacggcctatactaagaataatattgaa
aaaggtcatattgagtcgcaaagtattcagccaggtcaaaacgtggcagtgacgcaagat
aaagttgaagtcacagaatcactcggtaaacgtcaagtatatgtcggtgattatacgaac
aaagacatagatgatgtgaaagcagaattagaagaaaaaggacttgtcgttaaaattgaa
aaagaacgttcagaccgccgtgtgaaaaaacatcatattatcaatcactcgcctaaaaag
acaaatgtagaagagggcgatacggtgagctttatcgtatctacaggtgagaaagaagat
gatgaggacagtgattcagcggtgaaggcgtacagtgagacggtgaacattccttataca
ggtgaaagtgataagcctcaaaaagtagaagtttttattacagataaaaatgataatggt
caaagccctgctgaaacgtttaatattacacgagatacgccgcaaacgatgcaatttgtg
atagagaaaaataaatcggcgaaatatgtgattaaagtggatggtaaaacagtggcgaga
aagacgattgattttgatgatttttag

DBGET integrated database retrieval system